{"uniprot":"Q5FWF7","gene":"FBXO48","name":"F-box only protein 48","organism":"Homo sapiens (Human)","status":"dark","length":155,"sequence":"MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER","function_summary":"A soluble adaptor of an SCF ubiquitin ligase that uses an N-terminal F-box to assemble with SKP1 and build a CUL1–RBX1 E3 complex. By positioning substrates for polyubiquitin chain formation, it promotes their proteasome-dependent turnover and thereby supports cytosolic proteostasis. Its mechanism centers on high-affinity complex assembly and selective substrate capture rather than intrinsic catalysis, operating primarily in the cytosol with nucleocytoplasmic accessibility.","plain_language":"FBXO48 has barely been studied. The model's best guess: A soluble adaptor of an SCF ubiquitin ligase that uses an N-terminal F-box to assemble with SKP1 and build a CUL1–RBX1 E3 complex. By positioning substrates for polyubiquitin chain formation, it promotes their proteasome-dependent turnover and thereby supports cytosolic proteostasis.","uniprot_summary":"Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0031146","label":"SCF-dependent proteasomal ubiquitin-dependent protein catabolic process"},{"id":"GO:0000209","label":"protein polyubiquitination"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR036047","name":"F-box-like domain superfamily","type":"homologous_superfamily","start":31,"end":128},{"id":"IPR001810","name":"F-box domain","type":"domain","start":32,"end":81}],"reasoning":"I begin with the InterPro architecture. The polypeptide contains IPR036047 (F-box-like domain superfamily, residues 31–128), within which lies a more specific IPR001810 (F-box domain, residues 32–81). This arrangement—an N-terminal F-box embedded in a broader F-box-like scaffold—defines a canonical SCF (SKP1–CUL1–RBX1) E3 ubiquitin ligase adaptor. The F-box creates a high-affinity interface for SKP1, which nucleates assembly of the CUL1–RBX1 catalytic core. This architecture causes the protein to function primarily through multivalent protein binding rather than intrinsic catalysis, aligning with GO:0005515 protein binding as the molecular function.\n\nFrom this binding-centric F-box module, the mechanistic path to biological process becomes clear. By docking SKP1, the F-box adaptor recruits substrates via its variable regions and positions them for ubiquitin transfer by the RBX1–E2 module. This assembly drives GO:0000209 protein polyubiquitination and channels targets into GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process. The causal chain is direct: F-box-mediated SCF assembly enables polyubiquitin chain formation; polyubiquitin chains trigger recognition and degradation by the 26S proteasome.\n\nCellular localization follows from the soluble nature of SCF assemblies and the absence of transmembrane or secretion signals in the domain layout. SCF complexes predominantly operate in the cytosol and nucleocytoplasmic compartments, and the soluble F-box scaffold supports a cytosolic residence consistent with GO:0005829 cytosol. This soluble environment provides access to both cytoplasmic and nucleocytoplasmic substrates while allowing dynamic shuttling.\n\nIntegrating these features yields a coherent mechanism: the F-box adaptor binds SKP1 to assemble an SCF E3 ligase, captures specific substrates through auxiliary binding surfaces, and promotes their polyubiquitination for proteasomal turnover. Likely interaction partners follow from the assembly logic. The F-box domain dictates association with SKP1; through SKP1, the complex engages CUL1 and RBX1, which in turn recruit ubiquitin-conjugating enzymes such as CDC34/UBE2R1 and UBE2S. Downstream, polyubiquitinated substrates are handed off to proteasome receptors and shuttle factors. Thus, I hypothesize stable or transient interactions with SKP1, CUL1, RBX1, E2 enzymes, and proteasome-associated factors that collectively execute cytosolic ubiquitin-mediated proteostasis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5FWF7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5FWF7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5FWF7/entry","atlas":"/p/Q5FWF7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}