{"uniprot":"Q5JRK9","gene":"PAGE2B","name":"Putative G antigen family E member 3","organism":"Homo sapiens (Human)","status":"dark","length":111,"sequence":"MSEHVRTRSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENEGAPAVQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP","function_summary":"A cytosolic adaptor that uses a GAGE-type binding module to organize protein assemblies controlling gene expression. By scaffolding transcriptional and RNA-handling factors, it enhances expression of specific host loci and modulates pathways linked to cellular differentiation. Its soluble architecture positions it as a cytoplasmic hub that influences viral transcriptional hijacks of host machinery and fine-tunes host regulatory outputs.","plain_language":"PAGE2B has barely been studied. The model's best guess: A cytosolic adaptor that uses a GAGE-type binding module to organize protein assemblies controlling gene expression. By scaffolding transcriptional and RNA-handling factors, it enhances expression of specific host loci and modulates pathways linked to cellular differentiation.","uniprot_summary":"May enhance expression of some host target genes. May be involved in cellular differentiation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0019083","label":"viral transcription"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR031320","name":"GAGE","type":"domain","start":1,"end":111},{"id":"IPR008625","name":"G/X antigen","type":"family","start":1,"end":111}],"reasoning":"I begin with the InterPro architecture. The entire polypeptide (residues 1–111) is covered by IPR031320 (GAGE domain) and simultaneously classified within IPR008625 (G/X antigen family). This compact, single-domain layout indicates a non-enzymatic, adaptor-like module characteristic of cancer/testis antigen families. The absence of catalytic signatures and the dominance of a GAGE-type fold argue for a soluble binding platform that mediates multivalent protein–protein interactions rather than enzymatic chemistry. This architecture causally supports a molecular function centered on GO:0005515 protein binding.\n\nFrom this binding-centric foundation, I infer the biological role by considering how a GAGE-family adaptor could influence gene expression pathways. GAGE-like modules often assemble or modulate ribonucleoprotein and chromatin-associated complexes. Such assemblies can tune transcriptional outputs and RNA maturation steps. This mechanistic role naturally extends to viral gene expression systems that hijack host transcription and RNA handling machinery, aligning with GO:0019083 viral transcription. The same scaffolding logic explains how the protein can enhance expression of specific host loci and, by extension, modulate cellular differentiation programs.\n\nCellular localization follows from the soluble, single-domain architecture and the lack of transmembrane or secretion signals: the protein is cytosolic. This supports GO:0005829 cytosol and is consistent with a broader cytoplasmic residence where ribonucleoprotein assembly and trafficking occur. A cytosolic adaptor can shuttle signals and complexes between cytoplasm and nucleus indirectly, but its primary steady-state pool is cytosolic.\n\nMechanistically, I hypothesize that the GAGE domain forms a flexible scaffold that recruits transcriptional and RNA-processing factors to adjust viral transcription and selected host gene outputs. By stabilizing or remodeling assemblies of transcriptional regulators and RNA-binding proteins, it can bias promoter accessibility and transcript maturation. Likely interaction partners include chromatin and transcriptional modulators (e.g., KRAB-ZNF/KAP1 and heterochromatin components), elongation and RNA-processing factors, and cytosolic RNA-binding assemblies. Through these interactions, the protein can fine-tune viral transcriptional programs and host differentiation pathways from a cytosolic hub.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5JRK9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5JRK9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5JRK9/entry","atlas":"/p/Q5JRK9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}