{"uniprot":"Q5JRM2","gene":"CXorf66","name":"Uncharacterized protein CXorf66","organism":"Homo sapiens (Human)","status":"dark","length":361,"sequence":"MNLVICVLLLSIWKNNCMTTNQTNGSSTTGDKPVESMQTKLNYLRRNLLILVGIIIMVFVFICFCYLHYNCLSDDASKAGMVKKKGIAAKSSKTSFSEAKTASQCSPETQPMLSTADKSSDSSSPERASAQSSTEKLIRPSSLQKPSIPNSAGKLTRPSYPKRSSKSSCSKKLSKSSHLEKAHKKGSLEKLCKLDYACKLASSDKPVRPPQLFKPLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAETCQPYKKKHLVAKTYRPLVNDISEAKEKNTQNLHVSSKVKSSSRSFRKLDSRNNAYGDHVNDSDTMKYYSEVDSDKVIIITCDRGYNQVTSEVTLND","function_summary":"A soluble human adaptor that uses multivalent binding to organize complexes controlling calcium release from intracellular stores into the cytosol. It operates primarily in the cytoplasm and nucleus, where it couples calcium-dependent signaling to downstream transcriptional responses, and a fraction is sorted into extracellular vesicles. By scaffolding rather than catalyzing, it modulates ion-release platforms and coordinates broader cellular communication and gene-regulatory pathways.","plain_language":"CXorf66 has barely been studied. The model's best guess: A soluble human adaptor that uses multivalent binding to organize complexes controlling calcium release from intracellular stores into the cytosol. It operates primarily in the cytoplasm and nucleus, where it couples calcium-dependent signaling to downstream transcriptional responses, and a fraction is sorted into extracellular vesicles.","uniprot_summary":"May be involved in intracellular calcium signaling.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0051209","label":"release of sequestered calcium ion into cytosol"}],"cellular_component":[{"id":"GO:0070062","label":"extracellular exosome"}]},"interpro":[{"id":"IPR038873","name":"Uncharacterized protein CXorf66","type":"family","start":1,"end":361}],"reasoning":"I begin with the InterPro architecture: IPR038873 (Uncharacterized protein CXorf66 family) spans the entire polypeptide from residues 1–361, indicating a single, lineage-specific family domain that occupies the full length of the protein. A full-length family signature without embedded catalytic cores or membrane-anchoring motifs argues for a soluble, non-enzymatic scaffold/adaptor that mediates protein–protein interactions rather than catalysis. This architecture causally supports a binding-centric role consistent with GO:0005515 protein binding as the primary molecular function.\n\nA soluble adaptor that lacks transmembrane segments can still exert control over membrane-proximal events by assembling or modulating complexes that govern ion flux. The biological process label GO:0051209 release of sequestered calcium ion into cytosol points to regulation of Ca2+ mobilization from intracellular stores. A CXorf66-family scaffold can drive this process by coupling to channels and release machinery at endoplasmic reticulum or lysosome-associated membranes, where Ca2+ is released into the cytosol during signaling. The absence of enzymatic domains and the presence of a full-length interaction-prone family domain together cause a regulatory, not transport, mechanism: the protein tunes Ca2+ release by organizing or stabilizing release platforms rather than transporting ions itself.\n\nCellular localization further refines the model. The protein is detected in the cytoplasm and nucleus, and it is also found in extracellular exosomes (GO:0070062 extracellular exosome). Cytoplasmic and nuclear residence indicate nucleocytoplasmic shuttling, a hallmark of adaptors that coordinate signaling with transcriptional responses downstream of Ca2+ pulses. Packaging into exosomes suggests that a fraction of the protein is sorted via endosome-derived vesicles, implying transient association with endosomal membranes and participation in vesicle biogenesis pathways. Together, these observations support a soluble adaptor that operates primarily in the cytoplasm and nucleus, with a secondary route into extracellular vesicles.\n\nIntegrating these lines of evidence yields a coherent mechanism: a CXorf66-family scaffold that binds partners to regulate Ca2+ release into the cytosol and couples this ionic signaling to downstream nuclear responses. By assembling or tuning complexes that control Ca2+ efflux from intracellular stores, it indirectly modulates pathways that culminate in transcriptional and cytoskeletal outputs. Its presence in exosomes suggests an additional role in intercellular signaling via vesicle-mediated communication.\n\nFrom this mechanism, I hypothesize interaction partners that align with the inferred functions: Ca2+-handling assemblies at intracellular stores (e.g., IP3 receptor complexes and STIM/ORAI pathway components), endosomal/exosomal sorting modules (ESCRT machinery and tetraspanin-rich cargo platforms), and nucleocytoplasmic transport factors that enable shuttling between cytoplasm and nucleus. These partnerships would allow the protein to sense and relay Ca2+-dependent cues while being exported in exosome populations.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5JRM2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5JRM2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5JRM2/entry","atlas":"/p/Q5JRM2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}