{"uniprot":"Q5K130","gene":"CLLU1OS","name":"Putative chronic lymphocytic leukemia up-regulated protein 1 opposite strand transcript protein","organism":"Homo sapiens (Human)","status":"dark","length":101,"sequence":"MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEKM","function_summary":"A soluble human scaffold that assembles into tetramers to coordinate transcriptional regulation and signal-responsive pathways. By oligomerizing, it creates multivalent binding surfaces that recruit transcriptional and chromatin-associated factors in the nucleus and dynamically exchange with the cytosol. This architecture enables it to translate upstream signaling cues into nuclear regulatory assemblies that fine-tune gene expression programs.","plain_language":"CLLU1OS has barely been studied. The model's best guess: A soluble human scaffold that assembles into tetramers to coordinate transcriptional regulation and signal-responsive pathways. By oligomerizing, it creates multivalent binding surfaces that recruit transcriptional and chromatin-associated factors in the nucleus and dynamically exchange with the cytosol.","uniprot_summary":"May be involved in several cellular processes such as transcriptional regulation and signal transduction.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0051262","label":"protein tetramerization"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro: GO:0005515 protein binding (as a molecular-function label), but no catalytic domains or transmembrane segments are evident. The absence of enzymatic motifs and the presence of a binding-centric annotation point to a soluble, non-enzymatic scaffold that organizes higher-order assemblies through multivalent contacts. Such scaffolds frequently oligomerize to build functional platforms.\n\nThis binding-centric architecture directly supports GO:0005515 protein binding as the molecular function. The biological process label GO:0051262 protein tetramerization fits the inferred role: tetramerization is a common assembly pathway that increases local avidity and creates composite binding surfaces. In a nuclear context, tetrameric assemblies can nucleate or stabilize ribonucleoprotein condensates and chromatin-associated complexes.\n\nCellular localization is clarified by the soluble nature of the architecture and the reported compartments: GO:0005829 cytosol and GO:0005654 nucleoplasm. A soluble tetrameric scaffold that partitions between cytosol and nucleoplasm is well positioned to regulate transcriptional and RNA-processing hubs in the nucleus while remaining poised for nucleo-cytoplasmic exchange.\n\nThe functional description indicates involvement in transcriptional regulation and signal transduction. A non-enzymatic tetrameric binder in the nucleoplasm can causally influence transcription by recruiting or modulating transcriptional regulators and chromatin-associated assemblies. Its signal-transduction role follows from the same binding scaffold logic: upstream signaling pathways alter partner composition, which in turn tunes transcriptional outputs.\n\nMechanistically, I hypothesize that the protein forms homotetramers that seed dynamic nuclear assemblies. This oligomeric core increases binding valency, enabling selective capture of transcription factors, co-regulators, and RNA-processing factors. Cycling between cytosol and nucleoplasm allows it to relay cytosolic signaling states into nuclear transcriptional programs. Likely interaction partners include nuclear importins that mediate its shuttling, chromatin remodelers and histone-modifying enzymes that set transcriptional states, and nucleolar or speckle-associated RNA-binding proteins that stabilize higher-order assemblies.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5K130.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5K130"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5K130/entry","atlas":"/p/Q5K130"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}