{"uniprot":"Q5MJ10","gene":"SPANXN2","name":"Sperm protein associated with the nucleus on the X chromosome N2","organism":"Homo sapiens (Human)","status":"dark","length":180,"sequence":"MEQPTSSTNGEKRKSPCESNNKKNDEMQEAPNRVLAPKQSLQKTKTIEYLTIIVYYYRKHTKINSNQLEKDQSRENSINPVQEEEDEGLDSAEGSSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDEDLDSSEGSSQEDEDLDPPEGSSQEDEDLDSSEGSSQEGGED","function_summary":"A small, soluble nuclear adaptor that concentrates within the nucleoplasm and organizes protein assemblies controlling gene expression and cell-cycle programs. By scaffolding regulatory complexes in nuclear substructures, it enhances pathways that favor cell proliferation and growth, acting through multivalent protein interactions rather than catalysis to fine-tune transcriptional outputs that drive expansion of proliferating cell populations.","plain_language":"SPANXN2 has barely been studied. The model's best guess: A small, soluble nuclear adaptor that concentrates within the nucleoplasm and organizes protein assemblies controlling gene expression and cell-cycle programs. By scaffolding regulatory complexes in nuclear substructures, it enhances pathways that favor cell proliferation and growth, acting through multivalent protein interactions rather than catalysis to fine-tune transcriptional outputs that drive expansion of proliferating cell populations.","uniprot_summary":"Could be involved in cell proliferation and growth.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0008284","label":"positive regulation of cell population proliferation"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR010007","name":"SPAN-X family","type":"family","start":1,"end":95}],"reasoning":"I begin with the domain architecture: the sequence is entirely encompassed by IPR010007 (SPAN-X family, residues 1–95). This compact, single-module architecture typifies the X-linked SPAN-X family—small, non-enzymatic nuclear proteins that concentrate in nuclear bodies and often act as scaffolds or adaptors rather than catalysts. The absence of additional catalytic or transmembrane domains implies a soluble, interaction-centric molecule whose primary biochemical role is mediated through macromolecular binding. This architecture causally supports a molecular function centered on multivalent protein association, consistent with GO:0005515 protein binding.\n\nFrom this binding-centric core, I infer function and process. SPAN-X family proteins are known to accumulate in nuclear substructures and modulate gene-regulatory environments. A small adaptor that organizes nuclear complexes can bias transcriptional outputs and cell-cycle entry. Such modulation provides a mechanistic route to GO:0008284 positive regulation of cell population proliferation: by stabilizing transcriptional co-regulators and enhancing expression programs that favor proliferation, the protein promotes expansion of proliferating cell populations.\n\nCellular location follows directly from the soluble adaptor architecture and known nuclear targeting. The lack of membrane features and the propensity of SPAN-X family members to concentrate in nuclear condensates argue for a nuclear interior localization. This aligns with a soluble nuclear compartment assignment, GO:0005654 nucleoplasm, and with the broader nuclear residency expected for factors that tune transcription and RNA processing.\n\nMechanistically, I hypothesize that the SPAN-X family module nucleates assemblies within the nucleoplasm—potentially at nuclear bodies—where it binds other regulatory proteins to enhance pro-proliferative transcriptional circuits. Likely partners include nuclear body scaffolds and transcriptional regulators that govern cell-cycle and growth pathways. By concentrating these factors, the protein can increase the efficiency and fidelity of gene expression programs that drive proliferation, thereby manifesting its role as a nucleoplasmic organizer of growth-associated networks.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5MJ10.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5MJ10"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5MJ10/entry","atlas":"/p/Q5MJ10"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}