{"uniprot":"Q5T3Y7","gene":"BVES-AS1","name":"Putative uncharacterized protein BVES-AS1","organism":"Homo sapiens (Human)","status":"dark","length":98,"sequence":"MLRSTFTVHWTTILGICRPIKPIYKSQACPLSEKRNADNHLVSEDNTFKEPERYISSSCVLTSILYLGEKTFSFRTLISPRGMKLVEILQQPSLTMVA","function_summary":"A soluble mitochondrial adaptor that uses multivalent protein binding to assemble and stabilize macromolecular complexes governing mitochondrial architecture and function. By coordinating interactions among structural and regulatory partners, it helps maintain organelle organization and couples membrane remodeling and cristae maintenance to overall mitochondrial performance within human cells.","plain_language":"BVES-AS1 has barely been studied. The model's best guess: A soluble mitochondrial adaptor that uses multivalent protein binding to assemble and stabilize macromolecular complexes governing mitochondrial architecture and function. By coordinating interactions among structural and regulatory partners, it helps maintain organelle organization and couples membrane remodeling and cristae maintenance to overall mitochondrial performance within human cells.","uniprot_summary":"May play a role in mitochondrial function.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007005","label":"mitochondrion organization"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of a sole, broad binding signature and the absence of catalytic or transmembrane motifs indicate a soluble adaptor or scaffold rather than an enzyme or transporter. Such architectures typically mediate assembly and remodeling of macromolecular complexes through multivalent contacts.\n\nFrom this binding-centric core, the most direct molecular function is protein binding (GO:0005515). A non-enzymatic binder situated in mitochondria will exert its role by organizing or stabilizing assemblies that shape organelle form and function. This binding capacity causally supports a role in higher-order assembly pathways—precisely the operations encompassed by mitochondrion organization (GO:0007005). By coordinating interactions among mitochondrial structural and regulatory proteins, the protein can influence cristae maintenance, membrane dynamics, and nucleoid-associated processes that together define organelle architecture.\n\nThe cellular context follows from the same logic. A soluble, non-membranous binder that orchestrates assembly pathways is most effective in the mitochondrial compartment, aligning with mitochondrion (GO:0005739). The lack of predicted transmembrane segments and the need to interface with matrix-facing complexes further anchor the localization to the mitochondrial interior rather than membranes.\n\nMechanistically, a plausible model is that this factor nucleates or stabilizes assemblies that tune mitochondrial morphology and bioenergetic competence. It may transiently engage the mitochondrial fission/fusion machinery and inner-membrane organizing systems to balance organelle distribution and morphology. In this framework, the protein’s binding activity recruits and positions partners that regulate membrane curvature and cristae formation, thereby coupling structural state to metabolic output.\n\nThis model predicts interaction with mitochondrial dynamic regulators and architectural hubs. Likely partners include the major fission and fusion factors (DNM1L/DRP1, FIS1, MFF, MiD3/MIEF2, and the mitofusins), as well as inner-membrane organizers such as MICOS components (e.g., IMMT/MIC60). Additional associations with mitochondrial Rho GTPases (Miro1/2) and trafficking adaptors could route the assemblies toward cytoskeleton-coupled positioning. Together, these contacts would allow a soluble binder to choreograph mitochondrial organization in human cells.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5T3Y7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5T3Y7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5T3Y7/entry","atlas":"/p/Q5T3Y7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}