{"uniprot":"Q5TA82","gene":"LCE2D","name":"Late cornified envelope protein 2D","organism":"Homo sapiens (Human)","status":"dark","length":110,"sequence":"MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCCGPSSGGCCSSGGGGCCLSHHRPRLFHRRRHQSPDCCESEPSGASGCCHSSGGCC","function_summary":"A human late cornified envelope precursor that operates as a soluble, binding-competent scaffold during terminal differentiation of keratinocytes. It accumulates in the cytosol of epidermal cells before becoming cross-linked into the insoluble cornified envelope, where it helps fortify the skin barrier. Its assembly behavior is driven by multivalent protein interactions that are tuned by calcium-responsive differentiation pathways. By stabilizing envelope formation in the upper layers of the skin, it supports barrier integrity and indirectly influences neural and systemic physiology through epidermal–neuronal signaling crosstalk.","plain_language":"LCE2D has barely been studied. The model's best guess: A human late cornified envelope precursor that operates as a soluble, binding-competent scaffold during terminal differentiation of keratinocytes. It accumulates in the cytosol of epidermal cells before becoming cross-linked into the insoluble cornified envelope, where it helps fortify the skin barrier.","uniprot_summary":"Precursors of the cornified envelope of the epidermis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050890","label":"cognition"},{"id":"GO:0071277","label":"cellular response to calcium ion"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR028205","name":"Late cornified envelope protein","type":"family","start":25,"end":110}],"reasoning":"I begin with the InterPro architecture: a single annotated region, IPR028205 (Late cornified envelope protein family) spanning residues 25–110. This family signature defines a class of small, low-complexity structural precursors of the cornified envelope. Their hallmark is a propensity to become covalently cross-linked into the terminally differentiated keratinocyte scaffold during epidermal maturation. The N-terminal segment preceding residue 25 and the short C-terminal tail outside the family core typically provide flexible, intrinsically disordered regions that mediate multivalent contacts with other envelope components and keratins. This architecture favors extensive protein–protein association rather than catalysis, directly supporting GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric scaffold, I infer the biological role. Late envelope precursors are installed as keratinocytes exit the epidermal progenitor state and undergo terminal differentiation. Calcium-triggered differentiation programs drive envelope assembly; thus the protein’s binding-driven assembly behavior naturally participates in pathways that respond to calcium signals, aligning with GO:0071277 cellular response to calcium ion. The same structural logic explains why the protein is tied to higher-order organismal outcomes: epidermal integrity and barrier function feed into neural and systemic physiology. Perturbations in skin barrier signaling and neurotransmitter/catecholamine handling can propagate to brain circuits and systemic homeostasis, providing a mechanistic bridge to GO:0050890 cognition and a plausible route by which envelope-maturation factors influence cognitive pathways indirectly through neuroepidermal crosstalk and stress-axis modulation.\n\nCellular placement follows from the assembly route. Before cross-linking, envelope precursors are soluble and accumulate in the cytosol of differentiating keratinocytes, consistent with GO:0005829 cytosol. As things mature, they become immobilized within an insoluble shell beneath the plasma membrane; however, the soluble phase precedes and enables their assembly, and cytosolic residence is therefore a necessary stage in their life cycle.\n\nMechanistically, the late envelope family architecture causes multivalent, transient binding that nucleates supramolecular assemblies. Calcium elevation induces keratin filament bundling and recruits transglutaminase-driven cross-linking chemistry; this protein likely binds keratin intermediate filaments and envelope scaffold proteins, positioning it for subsequent covalent capture. I therefore hypothesize interactions with keratin pairs characteristic of upper epidermal layers and with envelope constituents such as loricrin and involucrin, as well as calcium-responsive adaptors. Through these assemblies, the protein stabilizes the maturing envelope, couples calcium-responsive differentiation to barrier formation, and indirectly influences neural and systemic physiology via epidermal–neuronal signaling axes.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5TA82.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5TA82"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5TA82/entry","atlas":"/p/Q5TA82"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}