{"uniprot":"Q5TBE3","gene":"C9orf153","name":"Uncharacterized protein C9orf153","organism":"Homo sapiens (Human)","status":"dark","length":101,"sequence":"MFLTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVISVNKMNKPGKHRKTPSPKINK","function_summary":"A small nucleoplasmic adaptor that lacks catalytic motifs and instead uses multivalent protein binding to assemble and stabilize chromatin-regulatory complexes. By recruiting and organizing heterochromatin machinery within the nucleus, it promotes chromatin compaction and transcriptional silencing, acting as a scaffold that helps establish and maintain repressive chromatin domains.","plain_language":"C9orf153 has barely been studied. The model's best guess: A small nucleoplasmic adaptor that lacks catalytic motifs and instead uses multivalent protein binding to assemble and stabilize chromatin-regulatory complexes. By recruiting and organizing heterochromatin machinery within the nucleus, it promotes chromatin compaction and transcriptional silencing, acting as a scaffold that helps establish and maintain repressive chromatin domains.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0031507","label":"heterochromatin formation"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR040022","name":"Uncharacterized protein C9orf153-like","type":"family","start":1,"end":91}],"reasoning":"I begin with the InterPro architecture: IPR040022 (Uncharacterized protein C9orf153-like family) spans residues 1–91 and covers essentially the entire polypeptide. A single, compact family signature without catalytic motifs indicates a small, soluble protein that functions primarily through macromolecular interactions rather than enzymatic chemistry. Such architectures typically mediate assembly or stabilization of nuclear complexes via low-complexity or adaptor-like surfaces, which causally supports a binding-centric molecular role consistent with GO:0005515 protein binding.\n\nFrom this binding-centric foundation, I infer function in chromatin regulation. The absence of enzymatic domains and the small size argue that the protein acts as a scaffold or recruiter that nucleates or stabilizes chromatin-modifying assemblies. This adaptor role naturally feeds into heterochromatin pathways—pathways that rely on multivalent interactions to compact chromatin and silence transcription—aligning with GO:0031507 heterochromatin formation. The causal chain is: a small interaction-optimized scaffold binds chromatin regulators; this assembly promotes nucleosome compaction and histone modification cascades; the resulting chromatin states accumulate as heterochromatin.\n\nCellular localization follows from function. A chromatin-organizing scaffold must operate where chromatin resides—the nucleoplasm—supporting GO:0005654 nucleoplasm. The experimentally observed nuclear residence is coherent with a nucleoplasmic adaptor that transiently engages chromatin and chromatin-modifying enzymes rather than membrane compartments.\n\nMechanistically, I hypothesize that the protein forms a nucleoplasmic hub that recruits heterochromatin machinery. By concentrating readers and writers of repressive marks (for example, H3K9 methylation and associated readers), it seeds and stabilizes compacted chromatin domains. Likely partners include H3K9 methyltransferases and their cofactors, HP1 family chromodomain proteins that propagate heterochromatin, and additional nuclear scaffolds. Through multivalent protein binding, the C9orf153-like module would couple these assemblies, biasing local chromatin toward a repressed, condensed state and thereby contributing to transcriptional silencing and genome organization.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5TBE3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5TBE3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5TBE3/entry","atlas":"/p/Q5TBE3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}