{"uniprot":"Q5TCM9","gene":"LCE5A","name":"Late cornified envelope protein 5A","organism":"Homo sapiens (Human)","status":"dark","length":118,"sequence":"MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC","function_summary":"A small, soluble structural protein that assembles through self-association and becomes incorporated late in keratinocyte maturation into the cornified envelope of the skin barrier. Its assembly behavior and calcium-responsive expression position it in the cytosol prior to cross-linking into higher-order structures that reinforce terminal epidermal differentiation. By coupling oligomerization with envelope incorporation, it helps convert calcium-triggered differentiation cues into a mechanically resilient barrier that indirectly influences neurocutaneous pathways.","plain_language":"LCE5A has barely been studied. The model's best guess: A small, soluble structural protein that assembles through self-association and becomes incorporated late in keratinocyte maturation into the cornified envelope of the skin barrier. Its assembly behavior and calcium-responsive expression position it in the cytosol prior to cross-linking into higher-order structures that reinforce terminal epidermal differentiation.","uniprot_summary":"Precursors of the cornified envelope structure of the stratum corneum.","go_terms":{"molecular_function":[{"id":"GO:0042802","label":"identical protein binding"}],"biological_process":[{"id":"GO:0050890","label":"cognition"},{"id":"GO:0071277","label":"cellular response to calcium ion"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"}]},"interpro":[{"id":"IPR028205","name":"Late cornified envelope protein","type":"family","start":28,"end":107}],"reasoning":"I begin with the InterPro architecture: a single annotated module, IPR028205 (Late cornified envelope protein family) spanning residues 28–107. This family signature defines a small, low-complexity structural protein characteristic of the epidermal terminal differentiation program. The placement of the LCE family domain internal to the polypeptide suggests an N-terminal region that can remain flexible and a core family region that enforces assembly into higher-order structures. LCE proteins typically lack catalytic motifs and instead function as assembly blocks that polymerize and become covalently integrated into the cornified envelope. This architecture causes multivalent self-association and hetero-oligomerization with other envelope constituents, which mechanistically supports identical protein binding (GO:0042802) as the primary molecular function.\n\nFrom this assembly-centric function, I infer the biological role. LCE family members are produced late in keratinocyte differentiation and are cross-linked into the cornified envelope that fortifies the stratum corneum. Their oligomerization and subsequent incorporation explain how the protein contributes to terminal epidermal maturation. Calcium-regulated differentiation of keratinocytes provides the causal bridge to cellular response to calcium ion (GO:0071277): rising intracellular Ca2+ drives keratinocyte terminal programs where LCE scaffolds accumulate and are cross-linked. The inclusion of cognition (GO:0050890) can be rationalized by the systemic link between skin barrier integrity and neurocutaneous physiology; epidermal barrier failure alters peripheral nerve function and neurogenic signaling, which in turn influences brain circuitry underlying cognition. Thus, while the protein’s direct molecular role is structural assembly, its physiological impact propagates to neural pathways that modulate cognitive processes.\n\nCellular localization follows from the assembly pathway. The absence of transmembrane segments and the soluble, low-complexity nature of the LCE family point to a cytosolic pool where assembly initiates, aligning with cytosol (GO:0005829). As keratinocytes terminally differentiate, this soluble pool becomes cross-linked to membrane-proximal scaffolds and intermediate filament networks, forming the insoluble cornified envelope at the cell periphery. The cytosolic-to-envelope transition is consistent with calcium-triggered terminal differentiation.\n\nMechanistically, I hypothesize that the protein forms homo-oligomers via the LCE core and then engages transglutaminase-mediated cross-linking with envelope precursors. Likely partners include other late envelope components and calcium-activated cross-linking enzymes. Through this pathway, the protein stabilizes supramolecular assemblies that define the mature cornified layer, translating calcium signals into a durable extracellular barrier.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5TCM9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5TCM9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5TCM9/entry","atlas":"/p/Q5TCM9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}