{"uniprot":"Q5TGI4","gene":"SAMD5","name":"Sterile alpha motif domain-containing protein 5","organism":"Homo sapiens (Human)","status":"dark","length":173,"sequence":"MCTNIVYEWLKALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVRRLREQDANAAGLYFTLEPQPAPPGPPADAVPTGRRGEPCGGPAQGTRGDSRGHTTAPRSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQSR","function_summary":"A cytoplasmic adaptor that uses a sterile alpha motif to assemble higher-order signaling complexes. By oligomerizing and recruiting pathway components, it enhances assembly and activity of the I-kappaB kinase module that drives NF-kappaB signaling. Its mechanism is scaffolding-driven: SAM-mediated clustering concentrates upstream adaptors and the IKK complex to potentiate pathway throughput in the cytoplasm.","plain_language":"SAMD5 has barely been studied. The model's best guess: A cytoplasmic adaptor that uses a sterile alpha motif to assemble higher-order signaling complexes. By oligomerizing and recruiting pathway components, it enhances assembly and activity of the I-kappaB kinase module that drives NF-kappaB signaling.","uniprot_summary":"May be involved in intracellular signaling pathways.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0043123","label":"positive regulation of I-kappaB kinase/NF-kappaB signaling"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"}]},"interpro":[{"id":"IPR013761","name":"Sterile alpha motif/pointed domain superfamily","type":"homologous_superfamily","start":1,"end":66},{"id":"IPR001660","name":"Sterile alpha motif domain","type":"domain","start":1,"end":65},{"id":"IPR051725","name":"SAM and SH3 domain-containing protein","type":"family","start":3,"end":164}],"reasoning":"I begin with the InterPro architecture. The N-terminus (residues 1–66) carries IPR013761, the Sterile alpha motif/pointed domain superfamily, and within it a well-defined SAM module, IPR001660 (Sterile alpha motif domain, residues 1–65). This tandem of a specific SAM domain nested inside the broader SAM superfamily establishes an oligomerization and interaction module that nucleates higher-order assemblies rather than catalysis. Extending beyond the core SAM, the sequence is classified as IPR051725 (SAM and SH3 domain-containing protein family, residues 3–164), indicating a broader adaptor-like family whose members organize signaling complexes through modular interaction surfaces. The ordered layout—an N-terminal SAM core followed by additional adaptor-family features—causes multivalent protein association capacity and favors assembly of cytoplasmic signaling hubs.\n\nFrom this architecture, the molecular function resolves as protein binding (GO:0005515). SAM domains drive homo- and hetero-oligomerization and often recruit pathway components through avidity effects; the absence of catalytic motifs and the presence of interaction-centric domains argue that binding and scaffolding are the primary biochemical activities.\n\nThis binding-centric design naturally feeds into pathway control. SAM-driven scaffolds frequently tune inflammatory and stress-responsive cascades. The explicit process implication is positive regulation of I-kappaB kinase/NF-kappaB signaling (GO:0043123). A SAM-centered adaptor can potentiate NF-kappaB by stabilizing upstream IKK complex assembly and coupling receptor-proximal adaptors to IKK activation. The causal chain is: SAM-mediated oligomerization concentrates signaling proteins, which increases IKK complex formation and activity, thereby enhancing NF-kappaB pathway throughput.\n\nCellular localization follows from the soluble, assembly-prone architecture and the lack of transmembrane segments or secretion signals. Such adaptor scaffolds operate in the cytoplasm (GO:0005737), where receptor-proximal and stress-response modules form transient complexes before nuclear translocation of NF-kappaB.\n\nMechanistically, I hypothesize that the SAM core seeds cytoplasmic puncta that recruit IKK complex constituents and upstream adaptors. Likely partners include TRAF-family adaptors and the IKK regulatory/catalytic subunits that together license NF-kappaB activation. By clustering these components, the scaffold raises local concentrations and fosters productive encounters, biasing the pathway toward activation. Additional transient contacts with cytoskeletal or endocytic elements could spatially coordinate receptor internalization and signal propagation, but the central mechanism is SAM-driven assembly that potentiates IKK/NF-kappaB signaling in the cytoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5TGI4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5TGI4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5TGI4/entry","atlas":"/p/Q5TGI4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}