{"uniprot":"Q5W188","gene":"CST9LP1","name":"Putative cystatin-9-like protein CST9LP1","organism":"Homo sapiens (Human)","status":"dark","length":147,"sequence":"MWSLPPSRALSCAPLLLLFSFQFLVTYAWRFQEEEEWNDQKQIAVYLPPTLEFAVYTFNKQSKDWYAYKLVPVLASWKEQGYDKMTFSMNLQLGRTMCGKFEDDIDNCPFQESPELNNTCTCFFTIGIEPWRTRFDLWNKTCSGGHS","function_summary":"A secreted human cystatin-like protein that deploys a cystatin fold to mediate high-affinity protein binding in the extracellular space. By assembling and stabilizing extracellular complexes, it modulates leukocyte and epithelial interfaces and contributes to soluble antimicrobial defense. Its architecture repurposes the classical cystatin inhibitory scaffold for immune-mediating interactions, enabling regulation of humoral antimicrobial pathways outside cells.","plain_language":"CST9LP1 has barely been studied. The model's best guess: A secreted human cystatin-like protein that deploys a cystatin fold to mediate high-affinity protein binding in the extracellular space. By assembling and stabilizing extracellular complexes, it modulates leukocyte and epithelial interfaces and contributes to soluble antimicrobial defense.","uniprot_summary":"Probable secreted protein.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0019730","label":"antimicrobial humoral response"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"}]},"interpro":[{"id":"IPR046350","name":"Cystatin superfamily","type":"homologous_superfamily","start":47,"end":143},{"id":"IPR000010","name":"Cystatin domain","type":"domain","start":49,"end":142},{"id":"IPR043250","name":"Cystatin-9-like","type":"family","start":1,"end":146}],"reasoning":"I begin with the InterPro architecture. The sequence is covered almost end-to-end by IPR043250 (Cystatin-9-like family, residues 1–146), indicating a secreted-type cystatin scaffold specialized for extracellular functions. Within this family envelope, the core inhibitory fold is specified twice: IPR046350 (Cystatin superfamily, residues 47–143) and IPR000010 (Cystatin domain, residues 49–142). This ordered layout—an N-terminal secreted-type cystatin framework followed by a canonical cystatin inhibitory core—establishes a compact beta-sandwich fold that typically mediates tight protein–protein interactions via a conserved wedge. In classical cystatins this wedge blocks cysteine proteases; however, in secreted, immune-associated cystatin-like proteins, the same architecture is repurposed to bind diverse extracellular partners and modulate inflammatory and antimicrobial pathways rather than acting as a classical enzyme inhibitor. This structural logic directly supports GO:0005515 protein binding as the molecular function.\n\nFrom this cystatin-based binding platform, the most parsimonious biological role is extracellular immune modulation. Secreted cystatin-like proteins commonly tune leukocyte behavior, cytokine availability, and barrier defense. The cystatin-9-like family signature (IPR043250) and the extracellular bias of the fold together drive a role in humoral antimicrobial defense—neutralizing pathogens through secreted factors and extracellular trapping matrices—aligning with GO:0019730 antimicrobial humoral response. The inhibitory fold’s versatility explains how the protein can scaffold or sequester partners without requiring catalytic activity.\n\nCellular location follows naturally from the architecture and function. The cystatin-9-like family frequently encodes secreted proteins, and the absence of intracellular retention motifs coupled with a secreted-type N-terminus points to extracellular deployment. This supports localization to the extracellular space (GO:0005615), consistent with a soluble secreted mediator that operates in tissue fluids and at epithelial surfaces.\n\nMechanistically, the cystatin fold creates a high-affinity interaction surface that organizes extracellular complexes. In the extracellular space, this architecture causes avid protein binding that can: (i) regulate leukocyte adhesion and migration by engaging cell-surface receptors and matrix components; (ii) shape antimicrobial humoral responses by clustering soluble effectors and stabilizing pathogen-binding assemblies; and (iii) buffer protease activity indirectly by recruiting protease regulators or by substituting for classical cystatin inhibition in the secreted milieu. I therefore hypothesize interactions with extracellular matrix proteins and cell-surface receptors on immune and epithelial cells, as well as soluble immune mediators. Likely partners include integrins and heparan sulfate proteoglycans for cell-surface anchoring, complement components and antimicrobial effectors for humoral defense, and cysteine protease regulators that co-assemble in secreted complexes. Together, these interactions explain how a secreted cystatin-like scaffold executes protein binding to drive antimicrobial humoral response in the extracellular compartment.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5W188.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5W188"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5W188/entry","atlas":"/p/Q5W188"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}