{"uniprot":"Q5W5W9","gene":"RESP18","name":"Regulated endocrine-specific protein 18","organism":"Homo sapiens (Human)","status":"dark","length":228,"sequence":"MAVDVEFGVAGWWEAAAPLSPSAVAATFTETWPGSERAEPGRIQHPLWPGSSEGLQLLVCFLLLNSCPGGCSDTSAHDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQGLFWKDDITQDAMIQKMEHASRLHPQEPCLKDGKALFPTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEIIYKIMRLLWATSYCGPQPCG","function_summary":"A soluble human adaptor that assembles regulatory complexes to control cholesterol handling and broader cellular programs. It operates primarily through multivalent binding rather than catalysis, forming a nucleoplasmic hub that coordinates transcriptional and RNA-processing pathways linked to endocrine regulation. By scaffolding these assemblies, it fine-tunes cholesterol metabolism and likely integrates signals that influence diverse cellular functions.","plain_language":"RESP18 has barely been studied. The model's best guess: A soluble human adaptor that assembles regulatory complexes to control cholesterol handling and broader cellular programs. It operates primarily through multivalent binding rather than catalysis, forming a nucleoplasmic hub that coordinates transcriptional and RNA-processing pathways linked to endocrine regulation.","uniprot_summary":"May be involved in various cellular functions.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0090181","label":"regulation of cholesterol metabolic process"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029403","name":"RESP18 domain","type":"domain","start":79,"end":155},{"id":"IPR024833","name":"Regulated endocrine-specific protein 18","type":"family","start":43,"end":190}],"reasoning":"I begin with the InterPro architecture. The core module is IPR029403 (RESP18 domain, residues 79–155), a hallmark domain that defines the Regulated endocrine-specific protein 18 family. This domain sits centrally within a broader family envelope, IPR024833 (Regulated endocrine-specific protein 18 family, residues 43–190), indicating that the conserved RESP18 fold is embedded in a larger scaffold that typically mediates multivalent macromolecular contacts rather than catalysis. The ordered layout—an internal conserved RESP18 domain framed by family-specific regions—implies a soluble, non-enzymatic adaptor that organizes protein assemblies. Such an adaptor architecture causally supports GO:0005515 protein binding as the primary molecular function: the RESP18 fold provides a structured platform for selective interactions that regulate downstream pathways.\n\nFrom this binding-centric scaffold, I infer the biological role by considering pathway context. The RESP18 family is classically linked to endocrine regulation and lipid/sterol handling. A non-catalytic adaptor that concentrates binding interfaces is well-suited to modulate transcriptional and trafficking hubs that govern sterol flux. This architecture therefore drives GO:0090181 regulation of cholesterol metabolic process: by assembling and positioning regulatory complexes that tune cholesterol biosynthesis and utilization, the protein exerts control without direct enzymatic activity.\n\nCellular placement follows from the absence of transmembrane features and the presence of nucleoplasmic function. The RESP18 domain’s soluble nature and its role in transcriptional and RNA/protein assembly pathways point to a nuclear soluble pool. This supports localization to GO:0005654 nucleoplasm, where the scaffold can coordinate gene-regulatory and RNA-processing assemblies that ultimately influence cholesterol metabolism and broader cellular programs.\n\nMechanistically, I propose that the RESP18 domain nucleates a nucleoplasmic hub that couples transcriptional control and RNA maturation to endocrine-responsive pathways. By concentrating binding partners, it modulates expression and trafficking nodes that determine cholesterol homeostasis. Likely interaction partners include nuclear import/export and chromatin-associated factors that gate sterol-responsive gene programs; cytoplasmic trafficking adaptors may transiently engage en route, but the decisive assembly occurs in the nucleoplasm where regulatory decisions are made. This scaffolded mechanism explains how a non-enzymatic protein binder exerts precise control over cholesterol metabolic regulation and broader cellular functions.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q5W5W9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q5W5W9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q5W5W9/entry","atlas":"/p/Q5W5W9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}