{"uniprot":"Q69YL0","gene":"NCBP2-AS2","name":"Uncharacterized protein NCBP2-AS2","organism":"Homo sapiens (Human)","status":"dark","length":99,"sequence":"MVLRRLLAALLHSPQLVERLSESRPIRRAAQLTAFALLQAQLRGQDAARRLQDLAAGPVGSLCRRAERFRDAFTQELRRGLRGRSGPPPGSQRGPGANI","function_summary":"A small human adaptor protein that operates through selective binding to assemble and stabilize pathways that deliver nuclear-encoded precursor proteins to mitochondria. Its compact, soluble architecture favors a regulatory role rather than catalysis, enabling it to coordinate with cytosolic chaperones and mitochondrial import machinery to ensure efficient targeting and handoff of cargo at the organelle surface.","plain_language":"NCBP2-AS2 has barely been studied. The model's best guess: A small human adaptor protein that operates through selective binding to assemble and stabilize pathways that deliver nuclear-encoded precursor proteins to mitochondria. Its compact, soluble architecture favors a regulatory role rather than catalysis, enabling it to coordinate with cytosolic chaperones and mitochondrial import machinery to ensure efficient targeting and handoff of cargo at the organelle surface.","uniprot_summary":"Involved in mitochondrial protein targeting.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006626","label":"protein targeting to mitochondrion"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR042407","name":"Protein NCBP2AS2","type":"family","start":1,"end":98}],"reasoning":"I begin with the InterPro architecture: IPR042407 (Protein NCBP2AS2 family) spans residues 1–98 and covers the entire polypeptide, indicating a compact, single-module protein without catalytic cores or transmembrane segments. A full-length family signature of this size typically encodes a regulatory adaptor rather than an enzyme. Such adaptors achieve function through selective macromolecular contacts, which causally supports a binding-centric molecular role consistent with GO:0005515 protein binding.\n\nA non-enzymatic adaptor that governs organelle-directed trafficking usually operates by docking onto transport assemblies. The biological process label GO:0006626 protein targeting to mitochondrion aligns with this architecture: a small, soluble factor can chaperone or stabilize import assemblies that deliver nuclear-encoded precursors to the mitochondrial surface and onward through the translocases. This causal chain—full-length adaptor domain leading to multivalent binding and assembly stabilization—places the protein squarely in the pathway that directs precursor proteins to mitochondria.\n\nCellular localization follows from the process and size. The absence of transmembrane features and the adaptor-like fold argue for a soluble factor that associates with organelles rather than embedding in membranes. Its role in mitochondrial targeting predicts association with the mitochondrial compartment, matching GO:0005739 mitochondrion. Mechanistically, such proteins often shuttle between the cytosol and mitochondria, transiently concentrating at the organelle to hand off cargo.\n\nPutting these elements together yields a mechanistic hypothesis: the NCBP2AS2-family architecture causes a protein-binding adaptor that organizes mitochondrial targeting. It likely binds components of cytosolic chaperone–import pathways and/or outer membrane translocases to promote efficient delivery of precursor proteins. From this, I hypothesize transient interactions with cytosolic Hsp70/Hsp90 systems and mitochondrial import receptors and channels—precisely the assemblies that determine the fidelity and throughput of mitochondrial protein targeting.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q69YL0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q69YL0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q69YL0/entry","atlas":"/p/Q69YL0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}