{"uniprot":"Q6IPR1","gene":"ETFRF1","name":"Electron transfer flavoprotein regulatory factor 1","organism":"Homo sapiens (Human)","status":"dark","length":90,"sequence":"MKMANSLRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTNKTN","function_summary":"A soluble mitochondrial matrix adaptor that uses an LYR-centered binding platform to regulate electron flow from ETF into the respiratory chain. By assembling and stabilizing ETF with its upstream dehydrogenase pathways and proximal respiratory assemblies, it fine-tunes electron throughput without catalyzing redox chemistry itself. Its matrix localization and LYR-driven scaffolding explain how it modulates energy transfer within mitochondria.","plain_language":"ETFRF1 has barely been studied. The model's best guess: A soluble mitochondrial matrix adaptor that uses an LYR-centered binding platform to regulate electron flow from ETF into the respiratory chain. By assembling and stabilizing ETF with its upstream dehydrogenase pathways and proximal respiratory assemblies, it fine-tunes electron throughput without catalyzing redox chemistry itself.","uniprot_summary":"May regulate electron transport from ETF into the respiratory chain.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0022904","label":"respiratory electron transport chain"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR008011","name":"Complex 1 LYR protein domain","type":"domain","start":10,"end":63},{"id":"IPR045296","name":"ETFRF1, LYR domain","type":"domain","start":22,"end":81},{"id":"IPR052000","name":"Electron transfer flavoprotein regulatory factor 1","type":"family","start":1,"end":88}],"reasoning":"I begin with the InterPro architecture. The polypeptide is compact and LYR-anchored: IPR008011 (Complex 1 LYR protein domain, residues 10–63) sits centrally and is flanked by IPR045296 (ETFRF1, LYR domain, residues 22–81), while the entire sequence is encompassed by IPR052000 (Electron transfer flavoprotein regulatory factor 1 family, residues 1–88). This arrangement—an LYR core embedded within an ETFRF1-specific envelope—defines a soluble mitochondrial adaptor specialized for respiratory-chain regulation rather than catalysis. LYR modules are hallmark mitochondrial matrix proteins that bind partner proteins and assembly factors, frequently coordinating respiratory complex biogenesis and acyl-carrier/ETF-linked pathways. The absence of enzymatic motifs and the dominance of LYR/adaptor signatures causally point to a molecular role centered on multivalent protein binding, aligning with GO:0005515 protein binding.\n\nFrom this binding-centric architecture, I infer function in electron-transfer control. The ETFRF1 family signature (IPR052000) ties the adaptor to electron transfer flavoprotein (ETF), whose physiological role is to funnel electrons from mitochondrial 2-oxoacid dehydrogenation reactions into the respiratory chain. An LYR-based adaptor that binds ETF and its client pathways naturally modulates electron flow into the chain, placing the protein squarely within GO:0022904 respiratory electron transport chain. By stabilizing ETF interactions and tuning their coupling to downstream complexes, the adaptor governs the throughput of electron flux without directly mediating redox chemistry.\n\nCellular location follows directly from the LYR module lineage and the ETFRF1 family context. LYR proteins are soluble mitochondrial matrix factors that dock onto respiratory assemblies; the ETFRF1 family is mitochondrial by construction. This supports a matrix-localized, soluble protein that operates proximal to respiratory complexes, consistent with GO:0005739 mitochondrion and the experimentally supported mitochondrial matrix localization.\n\nMechanistically, the LYR domain (IPR008011) provides a structured binding platform that recruits ETF and associated partners, while the ETFRF1-specific region (IPR045296) confers selectivity for ETF-centered electron-transfer nodes. This architecture causes regulated assembly of ETF with dehydrogenase complexes and, likely via transient contacts with assembly modules of the respiratory chain, ensures efficient electron delivery. I therefore hypothesize that the protein binds ETF and matrix-facing surfaces of respiratory assemblies to modulate electron throughput.\n\nFrom this model, I predict interaction with electron transfer flavoprotein itself and with matrix-facing respiratory assemblies. Likely partners include ETF subunits and matrix-exposed components that receive or deliver electrons. The adaptor may transiently engage complex I assembly factors and other LYR-family scaffolds to coordinate ETF coupling into the chain.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6IPR1.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6IPR1"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6IPR1/entry","atlas":"/p/Q6IPR1"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}