{"uniprot":"Q6L8G5","gene":"KRTAP5-10","name":"Keratin-associated protein 5-10","organism":"Homo sapiens (Human)","status":"dark","length":202,"sequence":"MGCCGCSGGCGSGCGGCGSGCGGCGSGCGGYGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGDCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCNCCKPCCCSSGCGSCCQSSCCNPCCCQSSCCVPVCCQSSCCKPCCCQSSCCVPVCCQCKI","function_summary":"A human nucleo-cytoplasmic regulatory protein that functions primarily through multivalent protein binding. By shuttling between cytoplasm and nucleus, it assembles regulatory complexes that tune the expression and trafficking of cell-adhesion machinery, thereby influencing heterophilic cell–cell adhesion. Its soluble architecture and absence of catalytic motifs indicate a scaffold-like role that coordinates cytoplasmic assemblies with nuclear programs to balance adhesion receptor availability and downstream adhesion outcomes.","plain_language":"KRTAP5-10 has barely been studied. The model's best guess: A human nucleo-cytoplasmic regulatory protein that functions primarily through multivalent protein binding. By shuttling between cytoplasm and nucleus, it assembles regulatory complexes that tune the expression and trafficking of cell-adhesion machinery, thereby influencing heterophilic cell–cell adhesion.","uniprot_summary":"Not known","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007157","label":"heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005634","label":"nucleus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence is annotated with a single broad cellular component signature, GO:0005634 nucleus, and a soluble compartment signature, GO:0005737 cytoplasm, with no explicit catalytic domains or enzymatic motifs. A solitary, non-enzymatic signature of this kind typically marks a regulatory, often nucleo-cytoplasmic shuttling protein that relies on protein–protein interactions rather than catalysis. This architecture causally supports a binding-centric molecular role, aligning with GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric foundation, the biological role is clarified by the process label GO:0007157 heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules. Heterophilic adhesion arises when distinct adhesion receptors on opposing cells form trans interactions that stabilize tissue architecture. A soluble nucleo-cytoplasmic binder can modulate this process indirectly by controlling the availability, localization, or transcriptional programs that govern adhesion molecule expression and trafficking. Thus, the architecture predicts a mechanism where protein binding governs adhesion outcomes without directly mediating membrane adhesion chemistry.\n\nCellular localization follows directly. The presence of GO:0005737 cytoplasm and GO:0005634 nucleus indicates a shuttling regulator that partitions between cytosolic pools and nuclear compartments. Such partitioning explains how a non-enzymatic binder exerts both pre-nuclear control (assembly with trafficking or cytoskeletal regulators) and intranuclear control (assembly with transcriptional or chromatin-associated complexes). This nucleo-cytoplasmic cycle provides a causal route to influence adhesion-related gene expression and to buffer signaling states that feed back on cell–cell adhesion.\n\nMechanistically, I hypothesize that the protein operates as a nucleo-cytoplasmic adaptor that tunes heterophilic adhesion by two coupled routes: (1) assembling cytoplasmic complexes that regulate endocytic recycling and cytoskeletal anchoring of adhesion receptors; and (2) entering the nucleus to modulate transcriptional programs that set the cellular repertoire of adhesion molecules. The absence of catalytic domains and the presence of strong nucleo-cytoplasmic signatures together argue for a scaffold-like binder that integrates adhesion signaling with gene regulatory machinery.\n\nThis model predicts interaction partners that match its binding-driven, shuttling mechanism. In the cytoplasm, it likely associates with adhesion pathway scaffolds and trafficking modules (e.g., catenin complexes and endocytic adaptors) that set surface levels of adhesion receptors. In the nucleus, it likely engages transcriptional regulators and chromatin-associated factors that calibrate expression of adhesion genes. Through these assemblies, the protein exerts system-level control over heterophilic cell–cell adhesion.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6L8G5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6L8G5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6L8G5/entry","atlas":"/p/Q6L8G5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}