{"uniprot":"Q6NSW7","gene":"NANOGP8","name":"Homeobox protein NANOGP8","organism":"Homo sapiens (Human)","status":"dark","length":305,"sequence":"MSVDPACPQSLPCFEESDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV","function_summary":"A nuclear transcription factor that uses a homeodomain to recognize specific regulatory DNA elements and assemble transcriptional complexes controlling cell-cycle and growth programs. By binding promoter and enhancer regions and recruiting co-regulators, it stimulates RNA polymerase II–dependent transcription that advances G1/S transition and promotes cell proliferation within the nucleoplasm.","plain_language":"NANOGP8 has barely been studied. The model's best guess: A nuclear transcription factor that uses a homeodomain to recognize specific regulatory DNA elements and assemble transcriptional complexes controlling cell-cycle and growth programs. By binding promoter and enhancer regions and recruiting co-regulators, it stimulates RNA polymerase II–dependent transcription that advances G1/S transition and promotes cell proliferation within the nucleoplasm.","uniprot_summary":"Transcription factor.","go_terms":{"molecular_function":[{"id":"GO:0003700","label":"DNA-binding transcription factor activity"},{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0000977","label":"RNA polymerase II transcription regulatory region sequence-specific DNA binding"}],"biological_process":[{"id":"GO:0008284","label":"positive regulation of cell population proliferation"},{"id":"GO:1902808","label":"positive regulation of cell cycle G1/S phase transition"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR009057","name":"Homeodomain-like superfamily","type":"homologous_superfamily","start":89,"end":155},{"id":"IPR001356","name":"Homeodomain","type":"domain","start":93,"end":157},{"id":"IPR050460","name":"Distal-less homeobox transcription factors","type":"family","start":7,"end":234},{"id":"IPR017970","name":"Homeobox, conserved site","type":"conserved_site","start":128,"end":151}],"reasoning":"I begin with the InterPro architecture. The core DNA-recognition module is IPR001356 (Homeodomain, residues 93–157), embedded within IPR009057 (Homeodomain-like superfamily, residues 89–155). This arrangement defines a helix-turn-helix fold that inserts a recognition helix into the major groove of DNA and confers sequence-specific binding. The presence of IPR017970 (Homeobox, conserved site, residues 128–151) marks the canonical DNA-contacting residues that stabilize high-affinity interactions with regulatory elements. Surrounding this core, IPR050460 (Distal-less homeobox transcription factors family, residues 7–234) assigns the protein to a metazoan transcription factor lineage that typically functions as developmental regulators. The ordered layout—an N-terminal family-defining region leading into a centrally placed homeodomain and capped by a conserved homeobox site—creates a modular transcription factor that binds specific promoter/enhancer sequences and recruits cofactors.\n\nThis domain architecture causes DNA-binding transcription factor activity. The homeodomain directly mediates GO:0003700 DNA-binding transcription factor activity and GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding by targeting regulatory modules upstream of Pol II-transcribed genes. The extended family region and flexible termini provide interaction surfaces for cofactors and chromatin machinery, supporting GO:0005515 protein binding as an intrinsic property of transcriptional regulation complexes.\n\nFrom this molecular function, the biological role follows. Homeobox transcription factors commonly drive cell-state transitions by activating growth and cycle-promoting gene networks. The ability to bind regulatory DNA and assemble co-regulatory complexes positions the protein to enhance expression of genes that propel cell cycle entry and expansion. This mechanistically explains participation in GO:0008284 positive regulation of cell population proliferation and GO:1902808 positive regulation of cell cycle G1/S phase transition: sequence-specific activation of cell-cycle and proliferation modules upstream of Pol II targets advances G1/S and amplifies proliferative outputs.\n\nCellular localization is dictated by function and sequence features. Homeodomains operate on chromatin within the nucleus, and soluble transcriptional assemblies typically reside in the nucleoplasm rather than being membrane-bound. Thus, the architecture and activity profile place the protein in the GO:0005654 nucleoplasm, consistent with a nuclear residence where it can scan and occupy regulatory DNA.\n\nA coherent mechanistic hypothesis emerges: the protein binds TAAT-rich homeobox motifs via its homeodomain, nucleates a transcriptional complex through its Distal-less family scaffold, and recruits co-activators to stimulate Pol II initiation and elongation at genes that drive proliferation and G1/S transition. Likely partners include general co-activators (e.g., CBP/p300) that acetylate chromatin, Mediator subunits that bridge to Pol II, and chromatin remodelers that open regulatory regions. Cooperative interactions with other developmental transcription factors and E-box-binding bHLH partners could refine target specificity and timing, collectively producing a proliferative transcriptional program within the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6NSW7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6NSW7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6NSW7/entry","atlas":"/p/Q6NSW7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}