{"uniprot":"Q6P5R6","gene":"RPL22L1","name":"60S ribosomal protein L22-like 1","organism":"Homo sapiens (Human)","status":"dark","length":122,"sequence":"MAPQKDRKPKRSTWRFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED","function_summary":"A core structural element of the human large ribosomal subunit that stabilizes ribosomal RNA and neighboring proteins to sustain cytoplasmic protein synthesis. It assembles with the ribosome during nuclear stages of biogenesis and functions in the cytoplasm as part of the translating pool. Its structural role and multivalent contacts explain observed associations with adhesion-linked translation sites and extracellular vesicles, reflecting both ribosome-rich cortical regions and packaging of ribosomal components into exosomes.","plain_language":"RPL22L1 has barely been studied. The model's best guess: A core structural element of the human large ribosomal subunit that stabilizes ribosomal RNA and neighboring proteins to sustain cytoplasmic protein synthesis. It assembles with the ribosome during nuclear stages of biogenesis and functions in the cytoplasm as part of the translating pool.","uniprot_summary":"Component of the large ribosomal subunit.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0003735","label":"structural constituent of ribosome"}],"biological_process":[{"id":"GO:0002181","label":"cytoplasmic translation"}],"cellular_component":[{"id":"GO:0022625","label":"cytosolic large ribosomal subunit"},{"id":"GO:0005634","label":"nucleus"},{"id":"GO:0070062","label":"extracellular exosome"},{"id":"GO:0005925","label":"focal adhesion"}]},"interpro":[{"id":"IPR038526","name":"Large ribosomal subunit protein eL22 superfamily","type":"homologous_superfamily","start":1,"end":122},{"id":"IPR002671","name":"Large ribosomal subunit protein eL22","type":"family","start":4,"end":119}],"reasoning":"I begin with the InterPro architecture. The sequence is entirely covered by IPR038526 (Large ribosomal subunit protein eL22 superfamily, residues 1–122) and by the nested IPR002671 (Large ribosomal subunit protein eL22 family, residues 4–119). This compact, single-module architecture is characteristic of eukaryotic large-subunit ribosomal proteins that form rigid RNA-binding scaffolds. The eL22 family is a basic, highly conserved ribosomal core component whose fold is optimized for stable incorporation into the 60S particle and for multivalent contacts with neighboring ribosomal proteins and rRNA. The absence of catalytic domains and the dominance of a ribosomal structural superfamily indicate a structural role rather than enzymatic chemistry.\n\nFrom this architecture, the molecular function resolves as a structural constituent of the ribosome that also engages in extensive macromolecular contacts. The eL22 fold creates a positively charged surface that binds rRNA and adjacent ribosomal proteins, which necessitates broad protein-binding capacity. This supports GO:0003735 structural constituent of ribosome and is consistent with GO:0005515 protein binding as an auxiliary binding function that arises from its assembly and stabilization roles.\n\nA structural ribosomal element directly drives cytoplasmic translation by stabilizing the large subunit and maintaining the geometry of the peptidyl transferase center and exit tunnel. This causally links the eL22 scaffold to GO:0002181 cytoplasmic translation. During ribosome biogenesis, eL22 family proteins transiently traffic through nuclear assembly pathways before accumulating in the cytoplasm as part of the translating pool.\n\nCellular localization follows from assembly and function. The mature complex resides in the cytoplasm as part of the GO:0022625 cytosolic large ribosomal subunit, aligning with a soluble ribosome pool in the cytoplasm. Ribosome assembly and export rationalize nuclear residency (GO:0005634 nucleus) during biogenesis. Detection in extracellular vesicles explains presence in GO:0070062 extracellular exosome, as ribosomal proteins and subunits are frequently packaged into exosomes during intercellular communication. Association with GO:0005925 focal adhesion is consistent with localized translation at adhesion-rich cortical regions, where ribosomes concentrate to synthesize adhesion and cytoskeletal regulators.\n\nMechanistically, eL22 stabilizes local rRNA architecture and forms a docking surface for neighboring large-subunit proteins and translation factors. I hypothesize that it transiently interacts with assembly factors and transport receptors in the nucleus and cytoplasm, and then with elongation and initiation complexes at adhesion-associated translation sites. Likely partners include neighboring 60S proteins and rRNA-processing/export factors during assembly, followed by cytoplasmic translation machinery that operates near focal adhesions and can be routed into exosome biogenesis pathways.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6P5R6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6P5R6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6P5R6/entry","atlas":"/p/Q6P5R6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}