{"uniprot":"Q6URK8","gene":"TEPP","name":"Testis, prostate and placenta-expressed protein","organism":"Homo sapiens (Human)","status":"dark","length":216,"sequence":"MARIIDLVPWDDGSTHVYASPAILLPMERQRNQLAGVKQQLYHPALPTLRHMDRDTVKACLPDEHCQSTTYCRKDEFDNAHFTLLGVPNKPLQCLDITATGQKLRNRYHEGKLAPIAPGINRVDWPCFTRAIEDWSHFVSSAGEFKLPCLRKRAEGLSGYAVRYLKPDVTQTWRYCLSQNPSLDRYGQKPLPFDSLNTFRSFGSSYSRVNYLTPWH","function_summary":"A human cytoplasmic and nucleoplasmic scaffold that associates with microtubules and sperm flagellar architecture while coordinating RNA-modifying assemblies. It operates through multivalent protein binding to stabilize axonemal and spermatid structures and to assemble nucleoplasmic complexes that influence RNA modification pathways relevant to germ cell biology. Its shuttling between cytoplasm and nucleus positions it to couple cytoskeletal organization with RNA-regulatory modules during spermatogenesis.","plain_language":"TEPP has barely been studied. The model's best guess: A human cytoplasmic and nucleoplasmic scaffold that associates with microtubules and sperm flagellar architecture while coordinating RNA-modifying assemblies. It operates through multivalent protein binding to stabilize axonemal and spermatid structures and to assemble nucleoplasmic complexes that influence RNA modification pathways relevant to germ cell biology.","uniprot_summary":"May be involved in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0009451","label":"RNA modification"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR034584","name":"Sperm microtubule inner protein 8","type":"family","start":1,"end":216}],"reasoning":"I begin with the InterPro architecture: IPR034584 (Sperm microtubule inner protein 8 family) spans residues 1–216 and covers the entire polypeptide. A single full-length family signature without catalytic subdomains indicates a non-enzymatic scaffold/adaptor specialized for microtubule biology and germline functions. Members of this family line the luminal face of axonemal doublet microtubules and form stable assemblies through multivalent contacts rather than enzymatic chemistry, which causally supports a primary molecular role in protein binding (GO:0005515).\n\nFrom this scaffold-centric architecture, the molecular function resolves as multivalent protein binding that organizes higher-order assemblies. The absence of recognizable catalytic motifs and the family’s known role as a microtubule inner protein together argue that the protein’s activity is to stabilize and regulate macromolecular complexes through specific binding interfaces rather than to modify substrates directly.\n\nThis binding-driven mechanism links upward to biological process. The family’s defining role in the male germline and axonemal architecture suggests a contribution to spermatogenesis and flagellar function. Concurrently, the protein is tied to RNA modification (GO:0009451). A plausible causal bridge is that a non-enzymatic scaffold can couple ribonucleoprotein assembly pathways to cytoskeletal platforms: by concentrating RNA-binding factors and/or providing docking surfaces in the nucleoplasm, it can bias the assembly and turnover of RNA-modifying complexes. Thus, its binding-centric architecture can indirectly steer RNA modification pathways that intersect with germ cell RNA regulation.\n\nCellular localization follows from both the domain logic and observed compartmentalization. The family signature and axonemal role place the protein in the cytoplasm and cytoskeleton, consistent with a soluble scaffold that associates with microtubules. Its presence in the nucleus and specifically the nucleoplasm (GO:0005654) indicates nucleocytoplasmic shuttling and assembly of nuclear RNA-modifying modules. This dual localization is coherent: nucleoplasmic residence enables assembly of RNA-processing complexes, while cytoplasmic/cytoskeletal residence enables axonemal and spermatid-associated structures.\n\nMechanistically, I hypothesize that the protein acts as a bifunctional adaptor. In the nucleoplasm, it scaffolds RNA-modifying assemblies that tune germ cell transcript maturation and stability. In the cytoplasm and along microtubules, it stabilizes axonemal and spermatid microtubule architectures. Likely interaction partners include tubulin heterodimers and axonemal microtubule-associated proteins on the cytoskeletal side, and nuclear RNA-modifying factors (such as snoRNP or RNA-editing assemblies) on the nucleoplasmic side. This division of labor explains how a single binding-competent scaffold can influence both microtubule-dependent structures and RNA modification pathways during spermatogenesis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6URK8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6URK8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6URK8/entry","atlas":"/p/Q6URK8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}