{"uniprot":"Q6UWQ7","gene":"IGFL2","name":"Insulin growth factor-like family member 2","organism":"Homo sapiens (Human)","status":"dark","length":119,"sequence":"MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP","function_summary":"A secreted, disulfide-rich extracellular signaling modulator that binds cell-surface receptors to tune pathway outputs controlling growth and differentiation. By engaging receptor ectodomains and extracellular cofactors, it dampens bone morphogenetic protein signaling while enhancing cytokine production pathways. Operating in the extracellular milieu, it assembles and remodels signaling complexes to fine-tune cell fate and proliferative responses.","plain_language":"IGFL2 has barely been studied. The model's best guess: A secreted, disulfide-rich extracellular signaling modulator that binds cell-surface receptors to tune pathway outputs controlling growth and differentiation. By engaging receptor ectodomains and extracellular cofactors, it dampens bone morphogenetic protein signaling while enhancing cytokine production pathways.","uniprot_summary":"May play a role in cell growth and differentiation.","go_terms":{"molecular_function":[{"id":"GO:0005102","label":"signaling receptor binding"}],"biological_process":[{"id":"GO:0001819","label":"positive regulation of cytokine production"},{"id":"GO:0030511","label":"negative regulation of BMP signaling pathway"}],"cellular_component":[{"id":"GO:0005615","label":"extracellular space"}]},"interpro":[{"id":"IPR032744","name":"Insulin growth factor-like family","type":"family","start":1,"end":117}],"reasoning":"I begin with the domain architecture: the sequence is entirely encompassed by IPR032744 (Insulin growth factor-like family, residues 1–117). This family encodes compact, disulfide-rich secreted ligands typified by insulin/IGF-like folds that stabilize small extracellular signaling proteins. The full-length coverage by a single secreted-ligand family and the absence of intracellular catalytic modules indicate a non-enzymatic, extracellular signaling molecule. Such IGFL architectures present solvent-exposed loops that mediate high-affinity contacts with cell-surface receptors and extracellular cofactors, which causally supports signaling receptor binding as the core molecular function.\n\nFrom this ligand-like scaffold, the most direct functional consequence is engagement of receptors to modulate downstream pathways. The IGFL fold is optimized for avid interactions with receptor ectodomains and co-receptors, which explains GO:0005102 signaling receptor binding. This binding capacity provides a mechanistic route to modulate pathway flux. In particular, an extracellular ligand can either potentiate or attenuate signaling by altering receptor clustering, co-receptor recruitment, or ligand availability.\n\nThe biological processes follow from how such a ligand-like protein rewires pathway outputs. First, suppression of BMP signaling can be achieved by competitive receptor occupancy or by sequestration of BMP co-receptors, which aligns with negative regulation of the BMP signaling pathway (GO:0030511). Second, extracellular modulators frequently bias immune and stromal circuits toward cytokine production; a secreted IGFL fold can stabilize or present cytokine-inducing cues, consistent with positive regulation of cytokine production (GO:0001819). Together, these processes rationalize a role in controlling cell growth and differentiation: attenuating BMP cues while enhancing cytokine milieu will fine-tune lineage decisions and proliferative set points.\n\nCellular location is dictated by the IGFL architecture and secretion signal logic. Disulfide-rich secreted folds are trafficked through the secretory pathway and deployed outside the cell, which places the protein in the extracellular space (GO:0005615). This extracellular residency is causally required for receptor binding and cytokine modulation and is fully compatible with the secreted designation.\n\nMechanistically, I hypothesize that the protein operates as an extracellular modulator that binds receptor ectodomains and BMP-pathway co-receptors to dampen BMP signal throughput while biasing cytokine production circuits. Likely interaction partners include BMP ligands and receptors (e.g., BMP2/4/7, BMPR complexes) and extracellular matrix or heparan-sulfate proteoglycans that scaffold signaling assemblies. By occupying or reshaping these assemblies, the protein tunes receptor availability and downstream SMAD-independent and SMAD-dependent branches, thereby coordinating growth and differentiation cues in the extracellular milieu.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6UWQ7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6UWQ7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6UWQ7/entry","atlas":"/p/Q6UWQ7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}