{"uniprot":"Q6UWV7","gene":"SHISAL2A","name":"Protein shisa-like-2A","organism":"Homo sapiens (Human)","status":"dark","length":190,"sequence":"MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVP","function_summary":"A single-pass membrane adaptor that dampens canonical Wnt signaling by assembling inhibitory complexes at intracellular membranes. Its luminal N-terminal module provides a high-affinity binding surface that captures membrane-tethered pathway components, while the transmembrane anchor and cytosolic tail recruit trafficking machinery. By biasing receptor and co-receptor routing through endosomal and Golgi checkpoints, it curtails signal propagation within the Wnt pathway and thereby tunes downstream cellular responses.","plain_language":"SHISAL2A has barely been studied. The model's best guess: A single-pass membrane adaptor that dampens canonical Wnt signaling by assembling inhibitory complexes at intracellular membranes. Its luminal N-terminal module provides a high-affinity binding surface that captures membrane-tethered pathway components, while the transmembrane anchor and cytosolic tail recruit trafficking machinery.","uniprot_summary":"Negatively regulates the canonical Wnt signaling pathway.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0090090","label":"negative regulation of canonical Wnt signaling pathway"}],"cellular_component":[{"id":"GO:0043231","label":"intracellular membrane-bounded organelle"}]},"interpro":[{"id":"IPR053891","name":"Shisa, N-terminal domain","type":"domain","start":4,"end":48},{"id":"IPR026910","name":"Shisa","type":"family","start":3,"end":167}],"reasoning":"I begin with the InterPro architecture. The polypeptide carries IPR053891 (Shisa, N-terminal domain, residues 4–48) embedded within a longer IPR026910 (Shisa family, residues 3–167) envelope. This arrangement typifies Shisa-type single-pass membrane modulators: an N-terminal luminal/extracellular Shisa domain that mediates ligand or receptor engagement, followed by a short luminal stalk and a C-terminal transmembrane anchor that tethers the protein to intracellular membrane-bounded organelles. The Shisa N-terminal module is known to create high-affinity protein–protein interfaces rather than catalytic sites, and the family signature spanning nearly the full length indicates a dedicated adaptor/scaffold whose primary chemistry is binding. This architecture therefore causes a binding-centric molecular function, consistent with GO:0005515 protein binding.\n\nFrom this binding-centric scaffold, I infer the biological role by considering pathway control. Shisa-family adaptors commonly attenuate signaling by stabilizing or routing pathway components through endosomal and Golgi membranes. A single-pass anchor combined with a luminal N-terminus positions the protein to capture and modulate membrane-tethered signaling assemblies. Such a layout is well-suited to dampen the canonical Wnt cascade by constraining receptor/co-receptor availability and trafficking. This mechanistic logic aligns with GO:0090090 negative regulation of canonical Wnt signaling pathway: by binding and sequestering pathway components or biasing their intracellular itinerary, the protein reduces Wnt signal throughput.\n\nThe cellular context follows directly from the membrane-anchored architecture and trafficking role. A single-pass membrane adaptor with a luminal N-terminus and cytosolic tail is inherently an integral membrane component that cycles through or resides within intracellular membrane-bounded organelles (endosomes, ER, Golgi). This supports GO:0043231 intracellular membrane-bounded organelle and explains the experimentally observed membrane localization. The cytosolic tail can recruit endocytic and sorting machinery, while the luminal Shisa domain stabilizes complexes at the membrane interface.\n\nPutting these elements together yields a mechanistic hypothesis. The Shisa N-terminal domain (IPR053891, 4–48) forms a luminal binding surface that captures Wnt pathway constituents—most plausibly the Frizzled/LRP co-receptor complex or the Wnt cargo itself—while the Shisa family framework (IPR026910, 3–167) provides the single-pass anchor and cytosolic interaction platform for clathrin adaptors and ESCRT/sorting modules. By stabilizing inhibitory assemblies and routing receptors toward endosomal/Golgi checkpoints, the protein reduces productive β-catenin signaling. Likely interaction partners include Frizzled receptors and LRP6 at the membrane, Dishevelled and Axin complexes via cytosolic adaptors, and trafficking factors such as AP complexes and Rab GTPases. This binding-driven, membrane-tethered mechanism explains the deduced molecular function (GO:0005515), the inhibitory Wnt role (GO:0090090), and the intracellular membrane residence (GO:0043231).","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6UWV7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6UWV7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6UWV7/entry","atlas":"/p/Q6UWV7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}