{"uniprot":"Q6UWW0","gene":"LCN15","name":"Lipocalin-15","organism":"Homo sapiens (Human)","status":"dark","length":184,"sequence":"MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPESKEAP","function_summary":"A secreted human lipocalin that forms a β-barrel cavity to sequester and transport hydrophobic metabolites, particularly retinoic acid, within the extracellular space. By transiently engaging partner proteins for cargo exchange at tissue interfaces, it buffers and distributes retinoids to cell-surface acceptors, thereby shaping local retinoic acid availability and influencing downstream metabolic pathways.","plain_language":"LCN15 has barely been studied. The model's best guess: A secreted human lipocalin that forms a β-barrel cavity to sequester and transport hydrophobic metabolites, particularly retinoic acid, within the extracellular space. By transiently engaging partner proteins for cargo exchange at tissue interfaces, it buffers and distributes retinoids to cell-surface acceptors, thereby shaping local retinoic acid availability and influencing downstream metabolic pathways.","uniprot_summary":"Involved in the binding and transport of small hydrophobic molecules.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0042573","label":"retinoic acid metabolic process"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR012674","name":"Calycin superfamily","type":"homologous_superfamily","start":17,"end":183},{"id":"IPR000566","name":"Lipocalin/cytosolic fatty-acid binding domain","type":"domain","start":34,"end":174},{"id":"IPR002345","name":"Lipocalin","type":"family","start":9,"end":176},{"id":"IPR022272","name":"Lipocalin family conserved site","type":"conserved_site","start":27,"end":40}],"reasoning":"I begin with the InterPro architecture. The core of the protein is defined by IPR012674 (Calycin superfamily, residues 17–183), a β-barrel superfamily that forms deep hydrophobic cavities for small-molecule sequestration. Nested within this scaffold is IPR000566 (Lipocalin/cytosolic fatty-acid binding domain, residues 34–174), which specifies the canonical lipocalin fold that creates a solvent-shielded pocket optimized for hydrophobic ligands. The sequence is further classified by IPR002345 (Lipocalin family, residues 9–176), anchoring the protein within extracellular carrier proteins that solubilize retinoids and other lipids. A short motif, IPR022272 (Lipocalin family conserved site, residues 27–40), marks conserved residues that stabilize the β-barrel mouth and govern ligand entry/exit. The ordered arrangement—calycin superfamily framework, lipocalin domain core, and lipocalin family signatures—causes formation of a secreted β-barrel carrier that binds and transports small hydrophobic metabolites.\n\nThis lipocalin architecture dictates molecular function. The enclosed hydrophobic cavity and conserved lipocalin mouth region drive high-affinity ligand capture and exchange, which necessitates transient macromolecular contacts during cargo handoff. Such transient interactions with receptors, co-carriers, and matrix components substantiate GO:0005515 protein binding as the operative molecular function: the fold is built to bind proteins as part of its transport cycle rather than to catalyze chemistry.\n\nFrom function to process, the cavity chemistry and lipocalin lineage point toward retinoid handling. Secreted lipocalins frequently chaperone retinoic acid and related metabolites by shielding their reactive hydrophobicity and by delivering them to cell-surface acceptors. This carrier role directly feeds into GO:0042573 retinoic acid metabolic process, because extracellular transport of retinoic acid governs its local activation/inactivation and distribution through tissues.\n\nCellular location follows from secretion and solubility. The absence of transmembrane segments and the lipocalin family’s extracellular specialization align with a soluble, exported protein. This supports localization to the GO:0005576 extracellular region and is consistent with a secreted status. In this compartment, the β-barrel carrier operates in fluids and pericellular spaces to distribute retinoids.\n\nMechanistically, the calycin/lipocalin barrel binds retinoic acid via a hydrophobic tunnel lined by aromatic residues; the conserved lipocalin site (residues 27–40) shapes the tunnel entrance that modulates ligand exchange kinetics. Secretion positions the protein to receive cargo from extracellular retinoid pools and to deliver retinoic acid to cell-surface acceptors. I therefore hypothesize that it transiently associates with cell-surface receptors and extracellular matrix components to effect cargo transfer. Likely partners include RAGE-family receptors that accept lipocalin cargos, other extracellular retinoid carriers that form exchange hubs, and heparan sulfate proteoglycans that concentrate the complex at tissue interfaces. Together, these interactions create a delivery system that tunes retinoic acid availability and thereby modulates downstream metabolic pathways.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6UWW0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6UWW0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6UWW0/entry","atlas":"/p/Q6UWW0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}