{"uniprot":"Q6XE38","gene":"SCGB1D4","name":"Secretoglobin family 1D member 4","organism":"Homo sapiens (Human)","status":"dark","length":83,"sequence":"MRLSVCLLMVSLALCCYQAHALVCPAVASEITVFLFLSDAAVNLQVAKLNPPPEALAAKLEVKHCTDQISFKKRLSLKKSWWK","function_summary":"A small secreted human protein that adopts a secretoglobin fold to function as an extracellular binder rather than an enzyme. By assembling transient complexes with cytokines, chemokines, and matrix components, it enhances inflammatory signaling in the extracellular milieu. Its binding-driven mechanism likely operates through dimerization and surface-mediated interactions that concentrate and present pro-inflammatory cues to nearby cells.","plain_language":"SCGB1D4 has barely been studied. The model's best guess: A small secreted human protein that adopts a secretoglobin fold to function as an extracellular binder rather than an enzyme. By assembling transient complexes with cytokines, chemokines, and matrix components, it enhances inflammatory signaling in the extracellular milieu.","uniprot_summary":"Involved in inflammatory processes.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050729","label":"positive regulation of inflammatory response"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR035960","name":"Secretoglobin superfamily","type":"homologous_superfamily","start":23,"end":82},{"id":"IPR016126","name":"Secretoglobin","type":"family","start":1,"end":83}],"reasoning":"I begin with the InterPro architecture. The sequence is fully encompassed by IPR016126 (Secretoglobin family, residues 1–83), with a nested IPR035960 (Secretoglobin superfamily, residues 23–82). This compact, secretoglobin fold is a hallmark of small secreted proteins that assemble as dimers and present solvent-exposed surfaces for ligand and protein contacts rather than catalytic active sites. The absence of enzymatic motifs and the dominance of a secreted, interaction-prone scaffold causally point to a non-enzymatic binder whose primary chemistry is macromolecular association. This architecture therefore drives a molecular function centered on GO:0005515 protein binding.\n\nA secreted binding module typically modulates extracellular signaling. Secretoglobins are classically induced in mucosal and inflammatory milieus and tune cytokine and chemokine pathways by sequestering ligands or docking onto receptors and matrix components. Such binding-driven modulation provides a direct route to GO:0050729 positive regulation of inflammatory response: by stabilizing receptor–ligand assemblies or concentrating pro-inflammatory cues, the protein can amplify inflammatory cascades in the extracellular space. The same binding-centric mechanism explains why it contributes to broader reproductive and inflammatory contexts—secreted secretoglobins often shape tissue-specific signaling niches.\n\nThe cellular location follows from the fold and secretion signal logic. Secretoglobins are secreted proteins that function outside the cell; thus the most parsimonious localization is GO:0005576 extracellular region. A soluble, secreted state ensures access to cytokines, chemokines, and cell-surface receptors where inflammatory amplification is executed.\n\nMechanistically, I hypothesize that this secretoglobin forms a stable homodimer that creates a hydrophobic cavity and complementary surface patches for transient complex assembly. By docking onto cytokines (e.g., IL-6 family members), chemokines, or extracellular matrix proteins, it concentrates and orients pro-inflammatory complexes near target cells, thereby enhancing receptor engagement and downstream signaling. Likely interaction partners include extracellular cytokines and chemokines, heparan sulfate proteoglycans that scaffold inflammatory gradients, and cell-surface receptors or co-receptors that sense these assemblies. This binding-centered mechanism coherently accounts for secretion, extracellular action, and the positive modulation of inflammation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6XE38.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6XE38"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6XE38/entry","atlas":"/p/Q6XE38"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}