{"uniprot":"Q6ZRX8","gene":"","name":"Putative uncharacterized protein FLJ45999","organism":"Homo sapiens (Human)","status":"dark","length":168,"sequence":"MSPTTGPQPNPRAWECHHTTGPQPNPRAWECHRMKGPQPNPRAWECHLRRVHNLTPEPGNVTIRGVHILTPEPGNVTIRGVHNLTPEPGNVTERGVHNLTPEPGNVTERGVHNLIPEPGNVTVKRGPQPNPRAWECHRTRGPQPNPRAWECHRTRGPQPNPRAWECHR","function_summary":"A soluble nuclear assembly factor that organizes early steps of tRNA maturation in human cells. It operates as a binding-driven scaffold within the nucleoplasm, recruiting and stabilizing RNA-processing machineries that act on nascent pre-tRNAs. By coordinating endonucleolytic cleavage and associated maturation steps without catalyzing reactions itself, it promotes efficient and accurate tRNA biogenesis through transient, multicomponent ribonucleoprotein assemblies.","plain_language":" has barely been studied. The model's best guess: A soluble nuclear assembly factor that organizes early steps of tRNA maturation in human cells. It operates as a binding-driven scaffold within the nucleoplasm, recruiting and stabilizing RNA-processing machineries that act on nascent pre-tRNAs.","uniprot_summary":"Involved in tRNA processing.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0008033","label":"tRNA processing"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro: GO:0005515 protein binding. This generic binding signature appears as the dominant feature of the polypeptide and, together with the absence of catalytic or RNAse domains, indicates a non-enzymatic adaptor or scaffold. A solitary binding-centric architecture typically mediates assembly of ribonucleoprotein complexes rather than performing chemistry itself. This causes the primary molecular function to be protein binding (GO:0005515), consistent with a factor that organizes other enzymes and substrates.\n\nFrom this binding-driven core, I infer the biological role by considering pathway context. The protein is implicated in tRNA processing (GO:0008033), a pathway that matures pre-tRNA through endonucleolytic cleavages and structural refinements. A non-catalytic binder in this pathway would stabilize and coordinate the endo/exonucleases and chaperones that act on pre-tRNA. The architecture therefore supports a role as an assembly factor that positions RNase P/MRP and associated maturation steps rather than executing cleavage itself.\n\nCellular localization follows from function and composition. The absence of transmembrane or secretion signals and the presence of a soluble binding scaffold point to a nuclear, non-membranous environment. tRNA transcription and early maturation occur in the nucleus, and many assembly steps concentrate in the nucleoplasm. This aligns with nucleoplasmic residency (GO:0005654 nucleoplasm), where pre-tRNA is escorted through surveillance and processing before export.\n\nMechanistically, a binding-centric scaffold in nucleoplasm can nucleate transient complexes that couple transcriptional output with processing. By concentrating RNase P/MRP components and auxiliary factors, the protein likely times endonucleolytic events and ensures correct folding and modification. I hypothesize that it binds both RNA-processing enzymes and pre-tRNA adaptors to choreograph handoffs within the nucleoplasm. Candidate partners include RNase P/MRP subunits and nucleoplasmic RNA maturation hubs; through these interactions, the protein enforces fidelity and throughput in tRNA biogenesis.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6ZRX8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6ZRX8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6ZRX8/entry","atlas":"/p/Q6ZRX8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}