{"uniprot":"Q6ZSK4","gene":"NTM-AS1","name":"Putative uncharacterized protein NTM-AS1","organism":"Homo sapiens (Human)","status":"dark","length":140,"sequence":"MKGQEGIRGEGCTDPEIKASPQMWAARFRGMRSRFSPLFSQATEMGPRVSAGWCLSGGGRKVSSLQGDFPPGGFWALSNDSALSLPPLSLPHPHPLRPPGLGVNEFTQGLHPPLHPAASVFQTCFYRKPHYCSTLRPTTT","function_summary":"A human nuclear regulatory scaffold that uses multivalent protein binding to assemble and stabilize transcriptional complexes controlling RNA polymerase II–dependent gene expression. By organizing transcription factors and co-regulators within the nucleoplasm, it modulates neuronal transcriptional programs that drive nervous system development and activity-dependent gene regulation.","plain_language":"NTM-AS1 has barely been studied. The model's best guess: A human nuclear regulatory scaffold that uses multivalent protein binding to assemble and stabilize transcriptional complexes controlling RNA polymerase II–dependent gene expression. By organizing transcription factors and co-regulators within the nucleoplasm, it modulates neuronal transcriptional programs that drive nervous system development and activity-dependent gene regulation.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007399","label":"nervous system development"},{"id":"GO:0006357","label":"regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro domain 1 (noted as the sole InterPro entry) that occupies the core of the polypeptide. The absence of catalytic signatures and the presence of a solitary, non-enzymatic domain point toward a regulatory scaffold that mediates macromolecular interactions rather than enzymatic chemistry. Such architectures typically encode low-complexity and coiled-coil elements that stabilize transient assemblies with transcriptional regulators and chromatin-associated factors. This domain layout causally supports a molecular function centered on multivalent protein binding, aligning with GO:0005515 protein binding.\n\nFrom this binding-centric core, the most direct functional consequence is transcriptional control. Proteins that assemble regulatory complexes in the nucleus frequently modulate RNA polymerase II output by recruiting or stabilizing transcription factors and co-regulators. This causal chain—interaction scaffold leading to assembly of transcriptional machinery—grounds the biological process GO:0006357 regulation of transcription by RNA polymerase II. Because transcriptional regulation in neurons underlies circuit formation and maturation, the same regulatory activity propagates into organismal pathways of GO:0007399 nervous system development.\n\nCellular localization follows from function and architecture. A soluble, non-membranous interaction hub that tunes polymerase II activity is expected to reside in the nuclear interior where active transcription and chromatin reside. This reasoning places the protein in the nucleoplasm, consistent with GO:0005654 nucleoplasm and with a nuclear subcellular location.\n\nMechanistically, I hypothesize that the protein operates as a nucleoplasmic adaptor that nucleates or stabilizes transcriptional assemblies. By binding transcription factors and co-regulators, it can fine-tune promoter-proximal pausing, enhancer–promoter communication, or chromatin accessibility. In neurons, this scaffolding would bias gene-expression programs that drive neurite outgrowth, synapse formation, and activity-dependent transcription. Likely partners include RNA polymerase II-associated complexes and neuronal transcriptional regulators; transient interactions with mediator and chromatin-modifying assemblies would couple signaling inputs to precise transcriptional outputs in the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q6ZSK4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q6ZSK4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q6ZSK4/entry","atlas":"/p/Q6ZSK4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}