{"uniprot":"Q7RTT4","gene":"SSX8","name":"Protein SSX8","organism":"Homo sapiens (Human)","status":"dark","length":187,"sequence":"MNGDDAFAKRPRDDDKASEKRSKAFNDIATYFSKKEWEKMKYSEKISYVYMKRNYEAMTKLGFNVTLPPFMCNKQATDFQGNYFDNDRNRRIQVERPQMTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLAPGKANTSEKINKRSGPKRGRHAWTHRLRERNQLVIYEEIRDPEEDDE","function_summary":"A nuclear transcriptional repressor that uses an N-terminal KRAB repression cassette to assemble corepressor complexes and a C-terminal SSXRD motif to engage chromatin and select genomic targets. By recruiting silencing machinery that deposits repressive histone marks and compacts chromatin, it dampens RNA polymerase II–driven gene expression within the nucleus. Its modular architecture supports multivalent protein interactions that stabilize a silenced chromatin state and fine-tune locus-specific repression.","plain_language":"SSX8 has barely been studied. The model's best guess: A nuclear transcriptional repressor that uses an N-terminal KRAB repression cassette to assemble corepressor complexes and a C-terminal SSXRD motif to engage chromatin and select genomic targets. By recruiting silencing machinery that deposits repressive histone marks and compacts chromatin, it dampens RNA polymerase II–driven gene expression within the nucleus.","uniprot_summary":"Transcriptional repressor.","go_terms":{"molecular_function":[{"id":"GO:0003714","label":"transcription corepressor activity"},{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005634","label":"nucleus"}]},"interpro":[{"id":"IPR036051","name":"Krueppel-associated box domain superfamily","type":"homologous_superfamily","start":19,"end":72},{"id":"IPR003655","name":"Ancestral KRAB domain","type":"domain","start":20,"end":83},{"id":"IPR001909","name":"Krueppel-associated box","type":"domain","start":23,"end":82},{"id":"IPR019041","name":"SSXRD motif","type":"conserved_site","start":161,"end":186}],"reasoning":"I begin with the InterPro architecture. The N-terminus carries a tightly clustered KRAB module: IPR036051 (Krueppel-associated box domain superfamily, residues 19–72) overlaps with IPR003655 (Ancestral KRAB domain, residues 20–83) and IPR001909 (Krueppel-associated box, residues 23–82). This layered annotation defines a canonical KRAB repression cassette positioned near the start of the protein. KRAB domains nucleate transcriptional silencing by recruiting corepressor assemblies that deposit repressive chromatin marks. The C-terminus contains IPR019041 (SSXRD motif, residues 161–186), a conserved site characteristic of SSX family proteins that mediates chromatin-associated interactions and DNA-proximal targeting. The ordered layout—an N-terminal KRAB repression engine followed by a C-terminal SSXRD targeting module—creates a bipartite regulator: the KRAB region imposes silencing capacity, while SSXRD confers chromatin engagement and locus selection.\n\nThis architecture dictates molecular function. The KRAB cassette is a well-established driver of transcriptional repression through assembly of corepressor complexes; thus the protein exerts GO:0003714 transcription corepressor activity. The presence of both KRAB and SSXRD motifs, neither of which encodes classical catalytic motifs, indicates a scaffold-like regulator that operates through multivalent macromolecular contacts, consistent with GO:0005515 protein binding. The combined effect is a modular repressor that binds partner proteins to silence transcription.\n\nFrom function to process, KRAB-driven repression causally leads to downregulation of RNA polymerase II–dependent genes. KRAB assemblies typically recruit TRIM28/KAP1, which in turn engages SETDB1 to install H3K9 methylation and stabilizes HP1-dependent heterochromatin. This cascade enforces promoter and enhancer silencing, aligning with GO:0000122 negative regulation of transcription by RNA polymerase II. The SSXRD motif further supports this by tethering the repression machinery to chromatin, ensuring durable repression.\n\nCellular location follows directly. A KRAB-centered transcriptional repressor must operate where chromatin and the transcriptional apparatus reside—the nucleus—matching GO:0005634 nucleus and the experimentally observed nuclear localization. The absence of transmembrane segments or secretion signals reinforces a soluble nuclear role.\n\nMechanistically, I hypothesize that the KRAB domain nucleates a repression hub by binding TRIM28/KAP1, which scaffolds SETDB1-mediated H3K9 methylation and HP1 loading to compact chromatin. The SSXRD motif likely refines genomic targeting by stabilizing chromatin contacts at specific loci, potentially including imprinted or X-linked regions often associated with SSX family proteins. In this model, the protein functions as a nuclear corepressor that assembles and positions silencing machinery to attenuate Pol II transcription. Likely interaction partners include TRIM28/KAP1 as the central adaptor, SETDB1 and HP1 family members as chromatin effectors, and additional chromatin remodelers that consolidate the repressed state.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q7RTT4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q7RTT4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q7RTT4/entry","atlas":"/p/Q7RTT4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}