{"uniprot":"Q7Z4H3","gene":"HDDC2","name":"HD domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":204,"sequence":"MASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVIKDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKELYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGRLQDFYDSTAGKFNHPEIVQLVSELEAERSTNIAAAASEPHS","function_summary":"A soluble human enzyme that hydrolyzes phosphate from deoxyribonucleotides and related nucleotide derivatives, thereby tuning deoxynucleotide pools and supporting nucleotide homeostasis. Its metal-activated catalytic core enables broad nucleotidase activity that catabolizes monophosphates and can extend to certain nucleotide tri- and diphosphates. The enzyme functions primarily in the cytosol, with dynamic association to nucleolar RNA-processing hubs and occasional membrane-proximal assemblies, where transient protein–protein interactions help position substrates and regulate activity.","plain_language":"HDDC2 has barely been studied. The model's best guess: A soluble human enzyme that hydrolyzes phosphate from deoxyribonucleotides and related nucleotide derivatives, thereby tuning deoxynucleotide pools and supporting nucleotide homeostasis. Its metal-activated catalytic core enables broad nucleotidase activity that catabolizes monophosphates and can extend to certain nucleotide tri- and diphosphates.","uniprot_summary":"5'-deoxynucleotidase involved in nucleotide metabolism. It catalyzes the hydrolysis of 5'-deoxynucleotides, including deoxyribonucleotides and deoxyadenosine monophosphate (dAMP). Some 5'-deoxynucleotides, such as inosine monophosphate (IMP), are not optimal substrates but it is possible that YFB/R-NAC can play a role in purine ribonucleotide or deoxyribonucleotide metabolism. It can also catalyze the hydrolysis of some nucleotide triphosphates and diphosphates.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0009159","label":"deoxyribonucleoside monophosphate catabolic process"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005886","label":"plasma membrane"},{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[{"id":"IPR006674","name":"HD domain","type":"domain","start":24,"end":176},{"id":"IPR003607","name":"HD/PDEase domain","type":"domain","start":42,"end":157},{"id":"IPR039356","name":"5'-deoxynucleotidase YfbR/HDDC2","type":"family","start":10,"end":203}],"reasoning":"I begin with the InterPro architecture. The polypeptide is dominated by an HD superfamily core: IPR006674 (HD domain, residues 24–176) forms the catalytic scaffold, and it is reinforced by IPR003607 (HD/PDEase domain, residues 42–157), which marks a metal-dependent phosphohydrolase fold that coordinates divalent cations to hydrolyze phosphoanhydrides and phosphomonoesters. Encompassing this core is IPR039356 (5'-deoxynucleotidase YfbR/HDDC2 family, residues 10–203), which specifies substrate class and biological role—members of this family hydrolyze 5'-deoxynucleotides. The ordered layout—an N-terminal family-defining envelope (IPR039356) that contains a central HD catalytic module (IPR006674/IPR003607)—causally dictates a metal-activated nucleotidase that cleaves phosphate from deoxyribonucleoside monophosphates and related nucleotide derivatives.\n\nThis HD/PDEase architecture establishes the molecular function. The HD domain’s metal-binding residues organize a two-metal center that activates water for nucleophilic attack on phosphate, producing inorganic phosphate and a nucleoside. That chemistry defines a phosphatase/nucleotidase activity and explains why the protein can act on 5'-deoxynucleotides and even some nucleotide tri- and diphosphates. The presence of broad interaction surfaces typical of HD-domain enzymes supports auxiliary GO:0005515 protein binding, consistent with transient assemblies that position substrates and regulate activity.\n\nFrom this catalytic base, the biological process follows. Hydrolysis of deoxyribonucleoside monophosphates funnels nucleotides into catabolic routes and prevents imbalances in deoxynucleotide pools. This directly implements GO:0009159 deoxyribonucleoside monophosphate catabolic process and provides a sink that buffers dNMP levels arising from DNA turnover and salvage pathways.\n\nCellular location is inferred from function and known trafficking of nucleotide metabolism. The soluble HD fold and absence of transmembrane segments argue for a cytosolic enzyme, aligning with GO:0005829 cytosol. Dynamic association with ribonucleoprotein-rich compartments during nucleotide turnover rationalizes presence in the GO:0005730 nucleolus, where rDNA transcription and RNA processing create local nucleotide flux. Occasional peripheral association with the GO:0005886 plasma membrane can arise through transient binding to membrane-proximal metabolic complexes or scaffolds that channel nucleotide intermediates near signaling hubs.\n\nMechanistically, the enzyme likely operates as a metal-dependent hydrolase that trims excess dNMPs and certain modified nucleotides, thereby stabilizing nucleotide homeostasis. It probably forms transient complexes with other nucleotide-metabolism enzymes and RNA-processing assemblies. I hypothesize interactions with cytosolic nucleotide-metabolism factors (e.g., kinases and phosphatases that interconvert NDP/dNMP), with nucleolar RNA-processing modules, and with membrane-proximal scaffolds that coordinate metabolic signaling. These assemblies would position substrates and tune activity to cellular demand, explaining its cytosolic core distribution with excursions to nucleoli and membrane-adjacent sites.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q7Z4H3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q7Z4H3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q7Z4H3/entry","atlas":"/p/Q7Z4H3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}