{"uniprot":"Q86SG4","gene":"HMGN2P46","name":"Putative Dresden prostate carcinoma protein 2","organism":"Homo sapiens (Human)","status":"dark","length":172,"sequence":"MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPSAYVPPLSLPPCPRERLKGMLKEIKPRLSRNCREDPQGCLLNLLLQSHSRSPERPLQRRERRYLQRRREKLMLARRGITLQKMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW","function_summary":"A soluble human adaptor that organizes the assembly of the ciliary axoneme. It operates through multivalent protein binding to stabilize and coordinate pre-assembly intermediates and transport pathways required for building the axonemal core. Its enrichment in the nucleoplasm suggests a staging role that regulates the timing and availability of assembly factors before their deployment to ciliogenesis sites, thereby driving efficient axoneme formation.","plain_language":"HMGN2P46 has barely been studied. The model's best guess: A soluble human adaptor that organizes the assembly of the ciliary axoneme. It operates through multivalent protein binding to stabilize and coordinate pre-assembly intermediates and transport pathways required for building the axonemal core.","uniprot_summary":"Involved in axoneme assembly.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0035082","label":"axoneme assembly"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro domain 1 (noted as the sole InterPro entry) that flags a conserved region of unknown enzymatic class but strong propensity for macromolecular association. The absence of catalytic signatures and the presence of a solitary interaction-prone domain argue that the polypeptide functions primarily as a scaffold or adaptor. Such architectures typically mediate multivalent contacts that stabilize higher-order assemblies rather than catalyzing reactions, which causally supports a binding-centric molecular function.\n\nFrom this scaffold-like core, the most direct molecular function is protein binding (GO:0005515). A non-enzymatic interaction hub can nucleate and stabilize macromolecular complexes. In this case, the biological role is revealed by the assembly logic it enables: axoneme assembly (GO:0035082). Axoneme biogenesis requires precise orchestration of microtubule-based structures and associated transport systems. A binding-centric adaptor can coordinate intraflagellar transport and axonemal subcomplex formation, thereby driving the stepwise construction of the ciliary core.\n\nCellular localization follows from this assembly pathway and its regulatory interface. The protein is detected in the nucleoplasm (GO:0005654), a compartment that often serves as a staging area for assembly factors and regulatory complexes before their deployment to cytoplasmic or nuclear-associated assembly sites. Nucleoplasmic residence is consistent with a soluble adaptor that cycles between nuclear and pericentriolar/ciliary assembly locales, supplying components and regulatory cues that tune axoneme formation.\n\nThese elements together suggest a mechanism: the protein acts as a soluble adaptor that binds multiple partners to choreograph axoneme assembly. It likely stabilizes pre-assembly intermediates and couples them to transport and quality-control pathways. By concentrating in nucleoplasmic pools, it can regulate the availability and timing of axonemal building blocks and their adaptors.\n\nThis model predicts interaction partners central to ciliogenesis and axoneme construction. Likely associates include intraflagellar transport complexes (IFT-B and IFT-A), dynein-2 and kinesin-2 motors that traffic cargo to the axoneme, and axonemal assembly factors such as radial spoke and nexin-dynein regulatory complex components. Upstream regulatory adaptors and chaperones that shepherd ciliary proteins through nucleoplasmic checkpoints would also be expected partners, collectively forming a dynamic assembly network that culminates in axoneme formation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q86SG4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q86SG4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q86SG4/entry","atlas":"/p/Q86SG4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}