{"uniprot":"Q86SH4","gene":"PRNT","name":"Putative testis-specific prion protein","organism":"Homo sapiens (Human)","status":"dark","length":94,"sequence":"MQHSLVFFFAVILHLSHLLHLDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVTHSLWHLQIPVDCQACNRKSKKIYC","function_summary":"A soluble human regulatory scaffold that uses a prion-like interaction module to assemble inhibitory complexes controlling gene expression. By concentrating corepressors and chromatin-modifying factors in the nucleus, it dampens RNA polymerase II–driven transcription programs relevant to testis-associated regulatory states. Its mechanism relies on multivalent protein binding that nucleates transient assemblies within the nucleoplasm to fine-tune transcriptional repression.","plain_language":"PRNT has barely been studied. The model's best guess: A soluble human regulatory scaffold that uses a prion-like interaction module to assemble inhibitory complexes controlling gene expression. By concentrating corepressors and chromatin-modifying factors in the nucleus, it dampens RNA polymerase II–driven transcription programs relevant to testis-associated regulatory states.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029172","name":"Putative testis-specific prion protein","type":"family","start":44,"end":94}],"reasoning":"I begin with the InterPro architecture: a single annotated region, IPR029172 (Putative testis-specific prion protein family) spanning residues 44–94. This family signature marks a prion-like, low-complexity module that typically lacks classical catalytic motifs and instead mediates multivalent macromolecular contacts. The placement of this family domain in the central-to-C-terminal portion of the polypeptide suggests that the N-terminus is likely compositionally flexible and adaptor-rich, while the annotated family core stabilizes oligomerization or phase-separated assemblies. Such prion-family architectures causally enforce protein-protein interaction capacity rather than enzymatic chemistry, directly supporting a primary molecular function of GO:0005515 protein binding.\n\nFrom this binding-centric scaffold, I infer regulatory rather than catalytic roles. Prion-family modules often tune transcription by assembling or sequestering transcriptional regulators. The explicit linkage to repression is mechanistically explained by a binding platform that recruits corepressors and chromatin modifiers to dampen RNA polymerase II output. This causal chain—from multivalent binding architecture to assembly of inhibitory complexes—maps to GO:0000122 negative regulation of transcription by RNA polymerase II.\n\nCellular placement follows from the same logic. A soluble, prion-like binder that modulates transcription must access chromatin-associated machinery. The nucleoplasm is the natural venue for such repression assemblies, aligning with GO:0005654 nucleoplasm. The absence of transmembrane features and the modular interaction domain favor a soluble nuclear pool that can dynamically shuttle and concentrate at transcriptional hubs.\n\nMechanistically, I hypothesize that the prion-family core nucleates transient oligomers that concentrate corepressor complexes (for example, HDAC-containing assemblies) and transcriptional repressors at specific genomic loci. By stabilizing these assemblies in the nucleoplasm, the protein attenuates initiation or elongation by RNA polymerase II. Likely interaction partners include nuclear corepressors and chromatin remodelers that recognize low-complexity scaffolds; together they would enforce repression programs relevant to testis-specific gene expression states.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q86SH4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q86SH4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q86SH4/entry","atlas":"/p/Q86SH4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}