{"uniprot":"Q8IU53","gene":"CASC2","name":"Protein CASC2, isoforms 1/2","organism":"Homo sapiens (Human)","status":"dark","length":76,"sequence":"MAGTRGLMLLGPGPVAGPRDVGTCRGRQMEIQKHKDNKKLPQGIIIVFRLQTHTTPQIYTQLKGKLRKFFKEPYSE","function_summary":"A soluble mitochondrial RNA–protein assembly factor that uses multivalent binding to stabilize mitochondrial transcripts and coordinate their delivery to the translation machinery. By organizing ribonucleoprotein complexes that protect and present mitochondrial mRNAs, it sustains organellar protein synthesis and thereby supports the structural and functional organization of mitochondria.","plain_language":"CASC2 has barely been studied. The model's best guess: A soluble mitochondrial RNA–protein assembly factor that uses multivalent binding to stabilize mitochondrial transcripts and coordinate their delivery to the translation machinery. By organizing ribonucleoprotein complexes that protect and present mitochondrial mRNAs, it sustains organellar protein synthesis and thereby supports the structural and functional organization of mitochondria.","uniprot_summary":"Plays a role in the regulation of mitochondrial mRNA stability.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0048255","label":"mRNA stabilization"},{"id":"GO:0007005","label":"mitochondrion organization"}],"cellular_component":[{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. Although no specific InterPro domains are annotated here, the functional narrative and localization together define a soluble mitochondrial RNA-associated factor. The absence of enzymatic signatures and the presence of a broad binding role point to a non-catalytic scaffold or adaptor that organizes ribonucleoprotein assemblies. Such adaptors typically rely on multivalent contacts with other proteins and RNAs to stabilize transcripts and coordinate translation. This architecture causally supports GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric core, I infer the biological processes. A soluble mitochondrial factor that stabilizes transcripts will directly promote mRNA longevity and ribosome engagement, which maps to GO:0048255 mRNA stabilization. Stabilization and translation control inside mitochondria feed into organelle biogenesis and maintenance pathways; by sustaining the expression of mitochondrial-encoded respiratory chain components, the protein indirectly drives organelle architecture and dynamics, aligning with GO:0007005 mitochondrion organization. The causal chain is: multivalent binding assembles RNA–protein complexes that protect and present mitochondrial mRNAs, which in turn sustains mitochondrial translation and assembly of oxidative phosphorylation machinery, thereby organizing the organelle.\n\nCellular location follows from both the functional logic and the provided localization. A soluble RNA–protein assembly factor that governs mitochondrial mRNA fate must reside in the mitochondrial compartment, consistent with GO:0005739 mitochondrion. The soluble nature and lack of transmembrane features further argue for a matrix- or inner-membrane–proximal ribonucleoprotein environment rather than a membrane-embedded state.\n\nMechanistically, I hypothesize that the protein forms a ribonucleoprotein hub that binds mitochondrial mRNAs and coordinates their stabilization with translation initiation and surveillance. By recruiting and stabilizing interactions with mitochondrial RNA-binding proteins and translation factors, it likely couples mRNA protection to ribosome loading and quality control. This hub would transiently engage other RNA-centric assemblies to tune transcript-specific stability and translation output.\n\nFrom this model, I predict interaction partners that operationalize mRNA stabilization and mitochondrial organization: mitochondrial RNA chaperones and helicases that manage transcript folding and decay; the mitochondrial small and large ribosomal subunits that receive stabilized mRNAs; and inner-membrane–associated assembly factors that couple translation to respiratory complex biogenesis. These associations collectively explain how a soluble binding platform exerts control over mitochondrial mRNA fate and organelle integrity.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IU53.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IU53"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IU53/entry","atlas":"/p/Q8IU53"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}