{"uniprot":"Q8IUE0","gene":"TGIF2LY","name":"Homeobox protein TGIF2LY","organism":"Homo sapiens (Human)","status":"dark","length":185,"sequence":"MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE","function_summary":"A nuclear transcriptional regulator that uses a homeodomain to recognize specific DNA motifs and assemble repression complexes in the nucleoplasm. By coupling high-affinity DNA binding with multivalent protein–protein interfaces, it recruits corepressors and chromatin-modifying factors to dampen RNA polymerase II–driven transcription at selected loci, thereby shaping gene-expression programs central to cellular identity and development.","plain_language":"TGIF2LY has barely been studied. The model's best guess: A nuclear transcriptional regulator that uses a homeodomain to recognize specific DNA motifs and assemble repression complexes in the nucleoplasm. By coupling high-affinity DNA binding with multivalent protein–protein interfaces, it recruits corepressors and chromatin-modifying factors to dampen RNA polymerase II–driven transcription at selected loci, thereby shaping gene-expression programs central to cellular identity and development.","uniprot_summary":"Transcriptional regulator.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:1990837","label":"sequence-specific double-stranded DNA binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR009057","name":"Homeodomain-like superfamily","type":"homologous_superfamily","start":50,"end":118},{"id":"IPR001356","name":"Homeodomain","type":"domain","start":48,"end":115},{"id":"IPR008422","name":"KN homeodomain","type":"domain","start":68,"end":107}],"reasoning":"I begin with the InterPro architecture. The core of the protein is a canonical homeobox module: IPR001356 (Homeodomain, residues 48–115) sits centrally and is encompassed by IPR009057 (Homeodomain-like superfamily, residues 50–118), indicating a helix-turn-helix fold specialized for sequence-specific DNA recognition. Nested within this region is IPR008422 (KN homeodomain, residues 68–107), a subclass of homeodomains whose structural features bias toward high-affinity, sequence-selective binding and often recruit transcriptional coregulators. The ordered layout—broad homeodomain-like superfamily envelope, a well-defined homeodomain core, and a KN subclass module—creates a DNA-binding scaffold that both recognizes specific double-stranded DNA motifs and provides surfaces for protein–protein interactions.\n\nThis architecture causes two primary molecular functions. First, the homeodomain and KN subclass dictate sequence-specific double-stranded DNA binding (GO:1990837), enabling precise promoter/enhancer targeting. Second, the extended homeodomain-like superfamily and KN subclass typically present interaction patches for cofactors and corepressors, supporting a general capacity for protein binding (GO:0005515). Together, these features define a transcriptional regulator that reads DNA and assembles regulatory complexes.\n\nFrom these molecular activities, the biological role follows. Homeodomain regulators frequently act as transcriptional switches that tune developmental and cell state programs. The KN subclass and the propensity for corepressor recruitment point toward repression of target loci transcribed by RNA polymerase II, aligning with negative regulation of transcription by RNA polymerase II (GO:0000122). Such repression can be deployed to sculpt developmental trajectories and cell identity, consistent with a role in transcriptional regulation.\n\nCellular localization is dictated by function and fold. Homeodomains operate on chromatin and require nuclear residency. The soluble, non-membranous architecture and reliance on chromatin engagement place the protein in the nucleoplasm (GO:0005654), consistent with a broader nuclear localization. The absence of transmembrane segments or secretion signals reinforces a nuclear, chromatin-proximal niche.\n\nMechanistically, the protein likely binds specific DNA motifs via its homeodomain core and stabilizes repression complexes through KN-mediated interfaces. It plausibly recruits corepressors and chromatin-modifying enzymes to attenuate transcriptional output at selected loci. I hypothesize transient assemblies with nuclear co-repressors and histone-modifying machinery—such as TLE/Groucho family adaptors and class I/II HDAC-containing complexes—to enforce promoter-proximal repression. Additional interactions with other homeobox proteins and general transcriptional machinery would fine-tune target selection and repression strength within the nucleoplasm.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IUE0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IUE0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IUE0/entry","atlas":"/p/Q8IUE0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}