{"uniprot":"Q8IVK1","gene":"GLYCAM1","name":"Putative glycosylation-dependent cell adhesion molecule 1","organism":"Homo sapiens (Human)","status":"dark","length":47,"sequence":"MKFFMVLLPASLASTSLAILDVESGLLPQLSVLLSNRLRGKTCQTGP","function_summary":"A human cell-surface adhesion molecule that presents a glycosylation-dependent extracellular domain to mediate calcium-independent cell–cell adhesion while using a single-pass type I topology to anchor at the membrane and assemble intracellular signaling complexes. By clustering and coupling to membrane-associated partners, it modulates heterotrimeric signaling pathways and fine-tunes receptor responses at the cell surface.","plain_language":"GLYCAM1 has barely been studied. The model's best guess: A human cell-surface adhesion molecule that presents a glycosylation-dependent extracellular domain to mediate calcium-independent cell–cell adhesion while using a single-pass type I topology to anchor at the membrane and assemble intracellular signaling complexes. By clustering and coupling to membrane-associated partners, it modulates heterotrimeric signaling pathways and fine-tunes receptor responses at the cell surface.","uniprot_summary":"Cell adhesion molecule that mediates cell-cell adhesion in a calcium-independent manner.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007186","label":"G protein-coupled receptor signaling pathway"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR007906","name":"Glycosylation-dependent cell adhesion molecule 1","type":"family","start":1,"end":22}],"reasoning":"I begin with the InterPro architecture: IPR007906 (Glycosylation-dependent cell adhesion molecule 1 family) occupies residues 1–22 at the N-terminus. This short, family-defining segment marks the polypeptide as a member of the glycosylation-dependent adhesion molecule lineage whose function hinges on dense N-linked glycosylation and an extracellular, membrane-proximal architecture. The compact N-terminal family signature, together with the experimentally observed single-pass type I topology, implies an N-terminal luminal/extracellular ectodomain that is heavily glycosylated and a C-terminal cytosolic tail. Such an arrangement causes avid, calcium-independent adhesion by presenting a highly glycosylated surface for homophilic or heterophilic contacts rather than enzymatic catalysis.\n\nFrom this domain logic, the molecular function resolves as non-enzymatic binding. The glycosylation-dependent adhesion module lacks catalytic motifs but is optimized for multivalent contacts; this supports GO:0005515 protein binding as the operative molecular function. The ectodomain’s adhesive surface and the cytosolic tail’s capacity for intracellular interactions together create a bidirectional binding hub.\n\nThis binding-centric architecture naturally feeds into signaling. A single-pass adhesion receptor can transduce information by clustering and coupling to membrane signaling assemblies. Such clustering can modulate heterotrimeric pathways, aligning with GO:0007186 G protein-coupled receptor signaling pathway. Adhesive clustering and cytosolic tail interactions provide a mechanistic route to tune GPCR outputs: lateral associations with GPCRs or their adaptors alter second-messenger fluxes without requiring intrinsic enzymatic activity.\n\nCellular location follows directly from the topology and secretion propensity. The type I signal architecture and glycosylation-dependent family identity place the ectodomain outside the cell and the tail inside, which situates the protein in the extracellular region (GO:0005576) at the cell surface. The explicit single-pass type I membrane annotation further constrains the site to the plasma membrane interface where extracellular adhesion and intracellular signaling converge.\n\nMechanistically, I hypothesize that the ectodomain forms calcium-independent adhesive clusters that stabilize cell–cell contacts, while the cytosolic tail nucleates complexes that modulate GPCR pathways. Likely partners include extracellular matrix or counter-receptors that drive homophilic adhesion, as well as membrane-proximal signaling proteins that couple adhesion to G protein pathways. This dual-surface design explains how a glycosylation-dependent adhesion molecule can both anchor cells and fine-tune receptor-mediated signaling.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IVK1.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IVK1"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IVK1/entry","atlas":"/p/Q8IVK1"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}