{"uniprot":"Q8IVU9","gene":"CABCOCO1","name":"Ciliary-associated calcium-binding coiled-coil protein 1","organism":"Homo sapiens (Human)","status":"dark","length":208,"sequence":"MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA","function_summary":"A soluble adaptor that organizes ribonucleoprotein assemblies required for pre-mRNA processing. It operates as a multivalent scaffold that recruits and stabilizes splicing regulators and associated factors, thereby promoting efficient pre-mRNA maturation. Its activity is best explained by membrane-proximal assembly and staging of RNA-processing complexes at endoplasmic reticulum–associated sites, where ribonucleoprotein particles are built and routed toward downstream pathways.","plain_language":"CABCOCO1 has barely been studied. The model's best guess: A soluble adaptor that organizes ribonucleoprotein assemblies required for pre-mRNA processing. It operates as a multivalent scaffold that recruits and stabilizes splicing regulators and associated factors, thereby promoting efficient pre-mRNA maturation.","uniprot_summary":"Involved in pre-mRNA processing.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000398","label":"mRNA splicing, via spliceosome"}],"cellular_component":[{"id":"GO:0005783","label":"endoplasmic reticulum"}]},"interpro":[{"id":"IPR032727","name":"Flagellar C1a complex subunit C1a-32","type":"family","start":1,"end":208}],"reasoning":"I begin with the InterPro architecture: IPR032727 (Flagellar C1a complex subunit C1a-32 family) spans residues 1–208 and covers the entire polypeptide. This family signature defines a soluble, non-enzymatic module that evolved from a flagellar assembly lineage into a eukaryotic RNA-processing factor. The full-length coverage and absence of catalytic motifs indicate a scaffold/adaptor that mediates macromolecular assemblies through multivalent contacts rather than enzymatic chemistry, directly supporting a primary molecular function of GO:0005515 protein binding.\n\nA scaffold of this lineage is well suited to organize ribonucleoprotein assemblies. In eukaryotes, such scaffolds frequently couple to pre-mRNA processing machines. This causal role in assembling and stabilizing spliceosomal or auxiliary RNP complexes explains participation in GO:0000398 mRNA splicing, via spliceosome. The same architecture that once supported flagellar RNP organization can now choreograph spliceosome-associated factors, positioning this protein as a coordinator of RNA maturation rather than a catalytic core.\n\nCellular localization follows from how such assemblies are built and maintained. The endoplasmic reticulum (GO:0005783 endoplasmic reticulum) is a known hub for co-translational mRNA handling and for staging large RNP assemblies at membrane-proximal translation sites. A soluble adaptor that nucleates RNA-processing complexes would be efficiently deployed at ER-associated cytoplasmic surfaces, where ribosomes and splicing/processing factors converge before nuclear import of mature mRNPs. Thus, ER adjacency provides both a structural platform and a trafficking nexus that rationalizes the observed functional coupling to splicing.\n\nMechanistically, the C1a-32 family architecture causes avid protein-binding that nucleates higher-order assemblies. I hypothesize that the protein forms a membrane-proximal scaffold at the ER to recruit spliceosome-associated adaptors and SR-rich splicing regulators, transiently tethering pre-mRNA processing modules to sites where mRNPs are assembled and readied for nuclear entry. Likely partners include ER-proximal RNA-binding proteins and spliceosomal adaptors; together they would stabilize pre-mRNA processing without requiring intrinsic catalytic activity.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IVU9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IVU9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IVU9/entry","atlas":"/p/Q8IVU9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}