{"uniprot":"Q8IW03","gene":"SIAH3","name":"Seven in absentia homolog 3","organism":"Homo sapiens (Human)","status":"dark","length":269,"sequence":"MLFFTQCFGAVLDLIHLRFQHYKAKRVFSAAGQLVCVVNPTHNLKYVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEAGLHANPVTPCLCMCPLFSCQWEGRLEVVVPHLRQIHRVDILQGAEIVFLATDMHLPAPADWIIMHSCLGHHFLLVLRKQERHEGHPQFFATMMLIGTPTQADCFTYRLELNRNHRRLKWEATPRSVLECVDSVITDGDCLVLNTSLAQLFSDNGSLAIGIAITATEVLPSEAEM","function_summary":"A soluble human E3-ligase–like scaffold that assembles TRAF-like binding modules to organize ubiquitination complexes controlling protein stability. By tuning the abundance of cytosolic substrates and targeting factors, it dampens pathways that direct proteins to mitochondria and thereby modulates mitochondrial engagement. Its pools in the nucleoplasm and at mitochondria enable coordinated control of substrate turnover and trafficking, with nucleoplasmic assemblies shaping availability and mitochondrial assemblies adjusting organelle-directed protein handling.","plain_language":"SIAH3 has barely been studied. The model's best guess: A soluble human E3-ligase–like scaffold that assembles TRAF-like binding modules to organize ubiquitination complexes controlling protein stability. By tuning the abundance of cytosolic substrates and targeting factors, it dampens pathways that direct proteins to mitochondria and thereby modulates mitochondrial engagement.","uniprot_summary":"May be involved in protein ubiquitination.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0031647","label":"regulation of protein stability"},{"id":"GO:1903215","label":"negative regulation of protein targeting to mitochondrion"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"},{"id":"GO:0005739","label":"mitochondrion"}]},"interpro":[{"id":"IPR008974","name":"TRAF-like","type":"homologous_superfamily","start":131,"end":259},{"id":"IPR018121","name":"Seven-in-absentia protein, TRAF-like domain","type":"domain","start":161,"end":255},{"id":"IPR004162","name":"E3 ubiquitin-protein ligase SINA-like, animal","type":"family","start":2,"end":268}],"reasoning":"I begin with the InterPro architecture. The sequence is encompassed almost end-to-end by IPR004162 (E3 ubiquitin-protein ligase SINA-like, animal family, residues 2–268), marking the polypeptide as a member of the SINA/SIAH animal E3 ligase family. Within this scaffold, the C-terminal half contains IPR008974 (TRAF-like homologous superfamily, residues 131–259) and, more specifically, IPR018121 (Seven-in-absentia protein, TRAF-like domain, residues 161–255). This ordered layout—an N-to-C SINA-like ligase framework capped by a C-terminal TRAF-like fold—creates a dimerizing β-sandwich platform that binds substrates and adaptor proteins. The TRAF-like domain stabilizes higher-order assemblies and positions catalytic and binding surfaces that drive ubiquitin transfer. This architecture causes broad protein-binding capacity and supports E3 ubiquitin ligase chemistry by assembling substrate complexes and recruiting ubiquitin machinery.\n\nFrom this domain logic, the primary molecular function resolves as multivalent protein binding (GO:0005515), with the TRAF-like core and SINA-like family membership explaining how the protein nucleates and organizes ubiquitination assemblies. The SINA/SIAH family frequently couples substrate recognition to ubiquitin transfer; even when catalytic residues vary, the fold enforces proximity-driven ubiquitination that modulates target stability.\n\nThese binding-driven assemblies directly explain two biological processes. First, by tagging substrates for proteasomal or lysosomal turnover, the complex regulates protein stability (GO:0031647). Second, the same ubiquitin-centered control can restrain mitochondrial targeting pathways—for example, by ubiquitinating cytosolic precursors or their chaperone/targeting factors—yielding negative regulation of protein targeting to mitochondrion (GO:1903215). The SINA-like scaffold provides the causal mechanism: selective ubiquitination alters the abundance and availability of mitochondrial-destined factors.\n\nCellular localization follows from both architecture and pathway context. The absence of transmembrane segments and the soluble TRAF-like fold support a cytosolic/nuclear soluble protein. Consistent with this, the protein is detected in the nucleoplasm (GO:0005654), where ubiquitin signaling often tunes transcriptional and RNA-processing hubs, and in mitochondria (GO:0005739), where it can influence precursor handling and organelle quality control. The dual presence is mechanistically coherent: nuclear pools regulate substrate availability and transcriptional programs, while mitochondrial pools modulate organelle-directed trafficking and turnover.\n\nA mechanistic hypothesis emerges: the SINA-like N-terminal region forms an oligomeric platform that binds substrates and adaptors, while the C-terminal TRAF-like domain enforces dimerization and substrate positioning. This assembly recruits ubiquitin-conjugation machinery to adjust substrate half-lives and thereby tunes mitochondrial targeting pathways. Likely interaction partners include ubiquitin-conjugating enzymes and mitochondrial targeting factors; nucleoplasmic associations may gate transcriptional responses that indirectly shape mitochondrial protein import. Together, these features explain how a soluble, nucleoplasmic and mitochondrial E3-scaffold modulates protein stability and restrains mitochondrial targeting through ubiquitin-centered control.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IW03.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IW03"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IW03/entry","atlas":"/p/Q8IW03"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}