{"uniprot":"Q8IYN6","gene":"UBALD2","name":"UBA-like domain-containing protein 2","organism":"Homo sapiens (Human)","status":"dark","length":164,"sequence":"MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR","function_summary":"A soluble human regulatory scaffold that uses a UBA-like binding module to assemble transient complexes controlling signaling and gene expression. By organizing cytosolic assemblies that attenuate MAPK and AKT pathways and nucleoplasmic complexes that fine-tune transcriptional programs, it restrains cell growth and can tip the balance toward apoptosis. Its compact architecture and lack of catalytic motifs indicate a binding-driven mechanism that coordinates proteostasis-linked signaling with transcriptional repression across cytosol and nucleoplasm.","plain_language":"UBALD2 has barely been studied. The model's best guess: A soluble human regulatory scaffold that uses a UBA-like binding module to assemble transient complexes controlling signaling and gene expression. By organizing cytosolic assemblies that attenuate MAPK and AKT pathways and nucleoplasmic complexes that fine-tune transcriptional programs, it restrains cell growth and can tip the balance toward apoptosis.","uniprot_summary":"May be involved in apoptosis. May be involved in regulation of cell cycle progression and gene transcription through inhibition of MAPK and AKT signaling pathways (By similarity).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030308","label":"negative regulation of cell growth"},{"id":"GO:0006355","label":"regulation of DNA-templated transcription"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR009060","name":"UBA-like superfamily","type":"homologous_superfamily","start":10,"end":49},{"id":"IPR054109","name":"UBA-like domain","type":"domain","start":9,"end":53},{"id":"IPR039310","name":"UBA-like domain-containing protein 1/2","type":"family","start":1,"end":164}],"reasoning":"I begin with the InterPro architecture. The polypeptide is defined by IPR039310 (UBA-like domain-containing protein 1/2 family) spanning residues 1–164, indicating a compact, soluble protein specialized for ubiquitin-associated signaling. Within this family scaffold, an N-terminal UBA-like module is present twice by concordant signatures: IPR054109 (UBA-like domain, residues 9–53) and the broader IPR009060 (UBA-like superfamily, residues 10–49). The ordered layout—an N-terminal UBA-like domain embedded in a small soluble family framework—creates a binding-centric architecture rather than a catalytic one. UBA-like domains typically recognize ubiquitin or ubiquitin-like surfaces and assemble transient protein complexes. This architecture causally supports a molecular function centered on multivalent protein binding, aligning with GO:0005515 protein binding.\n\nFrom this binding-centric core, I infer regulatory roles. UBA-like modules frequently tune transcriptional and proteostasis pathways by docking transcription factors and chromatin regulators. Such docking capacity explains how the protein can modulate transcriptional programs (GO:0006355 regulation of DNA-templated transcription). By assembling or stabilizing repressor complexes, it can dampen proliferative circuits, providing a mechanistic route to GO:0030308 negative regulation of cell growth. The same binding logic extends to signaling: by sequestering or scaffolding pathway components, the UBA-like module can attenuate MAPK and AKT axes and thereby influence cell cycle progression and apoptosis.\n\nCellular localization follows from the soluble, non-membranous architecture and the need to access both cytoplasmic signaling hubs and nuclear transcriptional machinery. The absence of transmembrane segments and the compact size favor a soluble distribution. The dual residency in the cytosol (GO:0005829) and nucleoplasm (GO:0005654) is therefore expected: cytosolic pools interface with MAPK/AKT signaling nodes, while nucleoplasmic pools engage transcriptional regulators and chromatin.\n\nMechanistically, I hypothesize that the UBA-like domain nucleates transient assemblies that gate pathway flux. In the cytosol, it likely binds ubiquitin-tagged adaptors or kinases to dampen MAPK and AKT cascades, thereby restraining cell growth and promoting apoptosis when thresholds are met. In the nucleus, it probably binds transcription factors and corepressors to fine-tune gene expression. This dual-compartment scaffolding explains how a single binding-centric module can simultaneously suppress growth, regulate transcription, and influence apoptosis.\n\nFrom this model, I predict interaction partners that match the inferred functions and locales. In the cytosol, associations with MAPK pathway components (e.g., RAF–MEK–ERK modules) and AKT pathway adaptors would be favored. In the nucleus, contacts with transcriptional repressors and chromatin modifiers (e.g., HDAC-containing complexes) are plausible. Ubiquitin and ubiquitin-pathway adaptors are natural partners for a UBA-like domain, stabilizing the assemblies that execute transcriptional and growth control.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8IYN6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8IYN6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8IYN6/entry","atlas":"/p/Q8IYN6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}