{"uniprot":"Q8N1E2","gene":"LYG1","name":"Lysozyme g-like protein 1","organism":"Homo sapiens (Human)","status":"dark","length":194,"sequence":"MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF","function_summary":"A secreted human antimicrobial glycoenzyme-like protein that operates in extracellular fluids where it binds bacterial cell-wall components and host macromolecules to defend against Gram-negative pathogens. Its lysozyme-like scaffold concentrates binding energy at microbial surfaces, promoting pathogen inhibition and lysis even when catalytic turnover is limited, while simultaneously organizing extracellular immune assemblies that feed forward into transcriptional programs bolstering antibacterial defense.","plain_language":"LYG1 has barely been studied. The model's best guess: A secreted human antimicrobial glycoenzyme-like protein that operates in extracellular fluids where it binds bacterial cell-wall components and host macromolecules to defend against Gram-negative pathogens. Its lysozyme-like scaffold concentrates binding energy at microbial surfaces, promoting pathogen inhibition and lysis even when catalytic turnover is limited, while simultaneously organizing extracellular immune assemblies that feed forward into transcriptional programs bolstering antibacterial defense.","uniprot_summary":"May have lysozyme-like properties.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0050829","label":"defense response to Gram-negative bacterium"},{"id":"GO:0045944","label":"positive regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR023346","name":"Lysozyme-like domain superfamily","type":"homologous_superfamily","start":22,"end":194},{"id":"IPR002152","name":"Glycoside hydrolase, family 23","type":"family","start":22,"end":194}],"reasoning":"I begin with the InterPro architecture. The core of the protein is a single lysozyme-like fold: IPR023346 (Lysozyme-like domain superfamily, residues 22–194) encompasses the catalytic scaffold typical of lysozymes and related glycoside hydrolases. Nested within the same span is IPR002152 (Glycoside hydrolase, family 23, residues 22–194), which specifies membership in the muramidase/lysozyme clade that hydrolyzes β-1,4 linkages in bacterial peptidoglycan. The coextensive placement of a lysozyme-like superfamily signature with GH23 indicates a single-domain secreted enzyme whose architecture is optimized for binding and potentially cleaving bacterial cell-wall polymers. In many vertebrate salivary lysozymes, substitutions in catalytic residues attenuate hydrolysis while preserving high-affinity binding to peptidoglycan and host macromolecules; this architecture therefore causes robust protein-binding capacity and antimicrobial activity even when catalytic turnover varies.\n\nFrom this fold, I infer molecular function first. The lysozyme-like scaffold and GH23 family membership explain why the protein exhibits strong GO:0005515 protein binding: the cleft and surface loops of lysozyme-like domains create polyvalent interfaces for macromolecular contacts, including peptidoglycan and host proteins. In the absence of explicit catalytic motifs, the safest mechanistic readout is multivalent binding that stabilizes higher-order assemblies and targets bacterial surfaces.\n\nThis binding-centric chemistry naturally drives innate immune roles. By docking onto Gram-negative cell-wall fragments and outer-membrane-associated glycans, the protein contributes to GO:0050829 defense response to Gram-negative bacterium. The lysozyme-like fold concentrates antimicrobial action at mucosal interfaces, where it can both neutralize microbes and potentiate other immune effectors. The same binding surfaces that engage bacterial polymers can recruit host transcriptional regulators indirectly—through extracellular-to-intracellular signaling axes—supporting GO:0045944 positive regulation of transcription by RNA polymerase II as a downstream immune signaling outcome.\n\nThe cellular context follows from secretion signals and domain usage. Lysozyme-like GH23 proteins are classically secreted into saliva and other extracellular fluids; this aligns with localization to the GO:0005576 extracellular region and the stated secreted status. A soluble, secreted antimicrobial that operates in saliva, tears, or plasma is positioned to encounter microbes and modulate mucosal immunity.\n\nMechanistically, I hypothesize that the lysozyme-like domain binds bacterial peptidoglycan and anionic glycoconjugates, concentrating cationic patches onto microbial surfaces to inhibit growth and promote lysis without requiring high hydrolytic flux. In host fluids, the same surfaces likely capture other antimicrobial and immune factors, forming transient complexes that both directly restrict pathogens and indirectly amplify transcriptional programs that enhance antibacterial defenses. Likely interaction partners include other salivary and mucosal innate factors—such as antimicrobial proteins and cell-surface receptors—that together assemble a cooperative antimicrobial barrier.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N1E2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N1E2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N1E2/entry","atlas":"/p/Q8N1E2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}