{"uniprot":"Q8N2C9","gene":"UMODL1-AS1","name":"Uncharacterized protein UMODL1-AS1","organism":"Homo sapiens (Human)","status":"dark","length":162,"sequence":"MAWGLPCHQNTAGANPHLFLGCYSTSSLQGLEYGGQRGDAHGKPGVLHGELEPHDHTSRLERHDLHSQLPTSVQVRHHWWEGALDLAKKRQQQTSINVFTTIKQGSRCDRWMVLGAISLLYNQEEAPDDRPLRARREVRSQHLSWAFPGTAGPGLVCAGDSQ","function_summary":"A germ cell–enriched adaptor that uses multivalent protein binding to assemble regulatory complexes controlling gene expression during gametogenesis. By scaffolding ribonucleoprotein and chromatin-associated assemblies, it promotes transcriptional and post-transcriptional programs that drive spermatid maturation and oocyte maturation. Its soluble architecture supports dynamic residence in the cytosol and nucleoplasm, enabling it to coordinate mRNA handling and nuclear regulatory steps that together elevate developmental outputs.","plain_language":"UMODL1-AS1 has barely been studied. The model's best guess: A germ cell–enriched adaptor that uses multivalent protein binding to assemble regulatory complexes controlling gene expression during gametogenesis. By scaffolding ribonucleoprotein and chromatin-associated assemblies, it promotes transcriptional and post-transcriptional programs that drive spermatid maturation and oocyte maturation.","uniprot_summary":"May be involved in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0001556","label":"oocyte maturation"},{"id":"GO:0010628","label":"positive regulation of gene expression"},{"id":"GO:0007286","label":"spermatid development"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The absence of catalytic InterPro signatures and the presence of a sole binding annotation indicate a non-enzymatic scaffold/adaptor whose primary chemistry is multivalent protein association. Such binding-centric architectures typically mediate assembly and regulation of ribonucleoprotein and chromatin-associated complexes rather than performing direct catalysis.\n\nFrom this binding-driven core, I infer molecular function first. A dedicated protein-binding capacity (GO:0005515) equips the protein to nucleate and stabilize higher-order assemblies. In germ cells, this architecture causes selective recruitment of RNA-processing factors and chromatin regulators, which in turn elevates transcriptional and post-transcriptional outputs—consistent with positive regulation of gene expression (GO:0010628). The lack of enzymatic motifs and the expectation of modular interactions argue that the protein’s activity is to organize and tune macromolecular complexes that control gene expression.\n\nThis binding-centric mechanism naturally extends to germ cell development. By assembling regulatory modules that drive differentiation checkpoints, the protein supports spermatid development (GO:0007286) and oocyte maturation (GO:0001556). The same scaffold can coordinate stage-specific programs in both male and female gametogenesis: in spermiogenesis it can couple cytosolic RNP remodeling with cytoskeletal reorganization; in oocyte maturation it can couple translational control and chromatin transitions. Positive regulation of gene expression provides the causal bridge that links binding to these developmental outcomes.\n\nCellular localization follows from where such assemblies operate. The soluble, adaptor-like nature and the need to interface with translational and transcriptional machinery place the protein in the cytosol (GO:0005829), where mRNP assembly and remodeling occur. Its role in tuning gene expression and developmental checkpoints also requires access to nuclear regulatory hubs, supporting a nucleoplasmic presence (GO:0005654). Dual cytosolic and nucleoplasmic residency enables it to shuttle between RNA handling and chromatin/transcriptional control as germ cells progress through differentiation.\n\nMechanistically, I hypothesize that the protein functions as a germ cell–specific scaffold that binds multiple partners to coordinate stage-dependent gene expression programs. In the cytosol, it likely engages RNA-binding and processing factors to bias mRNA selection and stability; in the nucleus, it may transiently associate with chromatin-modifying assemblies to fine-tune transcriptional outputs. This model predicts interactions with germ granule components and translational regulators in the cytoplasm and with transcription/chromatin modulators in the nucleoplasm, collectively driving spermatid maturation and oocyte maturation through regulated assembly and localization of macromolecular complexes.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N2C9.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N2C9"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N2C9/entry","atlas":"/p/Q8N2C9"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}