{"uniprot":"Q8N6F8","gene":"METTL27","name":"Methyltransferase-like protein 27","organism":"Homo sapiens (Human)","status":"dark","length":245,"sequence":"MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK","function_summary":"A soluble human methyltransferase that uses a SAM-dependent catalytic core to iteratively methylate lysine residues on protein substrates. By forming transient complexes with nuclear protein assemblies, it establishes and maintains specific lysine methylation states that modulate nucleoplasmic machineries involved in gene expression and RNA processing. Its active-site architecture enforces lysine selectivity and avoids histidine- and arginine-directed chemistry, situating the enzyme as a nuclear lysine-modifying catalyst that operates within nucleoplasmic complexes.","plain_language":"METTL27 has barely been studied. The model's best guess: A soluble human methyltransferase that uses a SAM-dependent catalytic core to iteratively methylate lysine residues on protein substrates. By forming transient complexes with nuclear protein assemblies, it establishes and maintains specific lysine methylation states that modulate nucleoplasmic machineries involved in gene expression and RNA processing.","uniprot_summary":"Protein-lysine methyltransferase that seems to catalyze iterative methylation (By similarity). Does not methylate histidine- or arginine-containing proteins (By similarity).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0018022","label":"peptidyl-lysine methylation"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029063","name":"S-adenosyl-L-methionine-dependent methyltransferase superfamily","type":"homologous_superfamily","start":19,"end":218},{"id":"IPR041698","name":"Methyltransferase domain 25","type":"domain","start":71,"end":161}],"reasoning":"I begin with the InterPro architecture. The polypeptide carries IPR029063 (S-adenosyl-L-methionine-dependent methyltransferase superfamily, residues 19–218), a Rossmann-like fold that binds S-adenosyl-L-methionine (SAM) and catalyzes methyl transfer. Nested within this scaffold is IPR041698 (Methyltransferase domain 25, residues 71–161), a catalytic core that shapes the SAM-binding pocket and positions nucleophilic lysine substrates for ε-methyl transfer. The ordered arrangement—an N-terminal SAM-dependent superfamily framework encompassing a central catalytic module—creates a soluble enzyme optimized for iterative lysine methylation chemistry rather than nucleic acid or small-molecule targets.\n\nThis SAM-dependent core dictates molecular function. The superfamily fold and MTase25 domain cause methyl group transfer to lysine ε-amines on protein substrates, a chemistry that inherently requires transient substrate recognition and complex assembly. Such assembly behavior supports GO:0005515 protein binding as an intrinsic property of catalysis and targeting, because efficient lysine methylation depends on forming specific enzyme–substrate and enzyme–adaptor complexes.\n\nFrom this catalytic logic, the biological process follows. Iterative methyl transfer onto peptidyl-lysine constitutes GO:0018022 peptidyl-lysine methylation. The architecture is characteristic of enzymes that generate mono-, di-, and tri-methyllysine states, and the absence of motifs that favor histidine or arginine chemistry explains why this system focuses on lysine and does not methylate histidine- or arginine-containing substrates.\n\nCellular location is inferred from where lysine methylation of chromatin-associated proteins is executed. The soluble SAM-dependent fold lacks transmembrane segments and secretion signals, favoring a nuclear, non-membranous environment. The functional coupling to chromatin-associated substrates and nuclear adaptors places the enzyme in the GO:0005654 nucleoplasm, where it can access transcriptional and RNA-processing assemblies.\n\nMechanistically, the enzyme binds SAM in the IPR029063 scaffold, uses the IPR041698 catalytic core to activate the ε-amine of lysine side chains, and iteratively deposits methyl groups to establish and maintain specific lysine methylation states. In the nucleoplasm, this activity likely tunes the assembly and dynamics of nuclear machines. I hypothesize that adaptor proteins and substrate cohorts—such as chromatin-associated factors and RNA-processing modules—guide substrate selection. Candidate partners include nuclear speckle and spliceosome-associated proteins that present lysine-rich motifs, as well as SAM-cycle enzymes that locally supply SAM and remove S-adenosyl-L-homocysteine. Together, these assemblies channel lysine methylation toward nuclear pathways while excluding histidine/arginine targets by active-site geometry.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N6F8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N6F8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N6F8/entry","atlas":"/p/Q8N6F8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}