{"uniprot":"Q8N7F7","gene":"UBL4B","name":"Ubiquitin-like protein 4B","organism":"Homo sapiens (Human)","status":"dark","length":174,"sequence":"MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ","function_summary":"A soluble adaptor that uses an N-terminal ubiquitin-like fold and a C-terminal TUGS module to assemble cytosolic ribonucleoprotein and targeting complexes that enhance delivery of mitochondrial precursor proteins. By stabilizing multivalent assemblies in the cytoplasm and nucleoplasm, it promotes efficient targeting pathways and coordinates cytosolic granule dynamics with mitochondrial import.","plain_language":"UBL4B has barely been studied. The model's best guess: A soluble adaptor that uses an N-terminal ubiquitin-like fold and a C-terminal TUGS module to assemble cytosolic ribonucleoprotein and targeting complexes that enhance delivery of mitochondrial precursor proteins. By stabilizing multivalent assemblies in the cytoplasm and nucleoplasm, it promotes efficient targeting pathways and coordinates cytosolic granule dynamics with mitochondrial import.","uniprot_summary":"May be involved in targeting proteins to the mitochondria.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:1903955","label":"positive regulation of protein targeting to mitochondrion"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR029071","name":"Ubiquitin-like domain superfamily","type":"homologous_superfamily","start":1,"end":79},{"id":"IPR000626","name":"Ubiquitin-like domain","type":"domain","start":1,"end":72},{"id":"IPR041421","name":"Ubl4, C-terminal TUGS domain","type":"domain","start":91,"end":137},{"id":"IPR043317","name":"Ubiquitin-like protein 4B","type":"family","start":1,"end":174}],"reasoning":"I begin with the InterPro architecture. The N-terminus (residues 1–79) is covered by IPR029071 (Ubiquitin-like domain superfamily), with a core Ubl fold annotated as IPR000626 (Ubiquitin-like domain, residues 1–72). This β-grasp Ubl scaffold is a canonical protein–protein interaction module that forms stable heterotypic interfaces rather than catalyzing chemistry. The C-terminus carries IPR041421 (Ubl4, C-terminal TUGS domain, residues 91–137), a hallmark adaptor element that engages cytosolic RNA-binding assemblies and targeting factors. The full-length sequence is classified as IPR043317 (Ubiquitin-like protein 4B family, residues 1–174), specifying a soluble adaptor specialized for mitochondrial precursor handling. The ordered layout—an N-terminal Ubl interaction platform followed by a C-terminal TUGS adaptor—creates a bipartite binding machine that nucleates large ribonucleoprotein and targeting complexes.\n\nThis domain architecture dictates molecular function as multivalent protein binding (GO:0005515). The Ubl core provides a rigid interaction surface that stabilizes assemblies, while the TUGS domain recruits partners central to cytosolic RNA granules and mitochondrial targeting pathways. The absence of catalytic motifs and the presence of two distinct binding modules argue that the protein acts as a scaffold/adaptor rather than an enzyme.\n\nFrom this binding-centric mechanism, the biological process emerges. The TUGS domain is a signature of adaptors that chaperone mitochondrial precursor pathways and RNA granule dynamics. By stabilizing assemblies that shepherd preproteins toward the organelle, the protein positively regulates protein targeting to mitochondria (GO:1903955). The same architecture that organizes cytosolic granules can bias precursor flux toward mitochondrial import routes, explaining its role in enhancing targeting efficiency.\n\nCellular localization follows directly from solubility and adaptor function. The Ubl–TUGS scaffold lacks transmembrane segments and secretion signals, favoring a soluble distribution in the cytosol (GO:0005829). Its participation in ribonucleoprotein assemblies and stress-responsive granules can extend into the nucleoplasm (GO:0005654), consistent with shuttling and RNA-processing interfaces. The experimentally observed cytoplasmic presence aligns with this soluble, ribonucleoprotein-centric residency.\n\nMechanistically, I hypothesize that the N-terminal Ubl fold forms a stable platform that binds partner adaptors, while the C-terminal TUGS domain captures RNA-binding factors and mitochondrial-targeting modules. This causes assembly of cytosolic granules that triage and deliver mitochondrial precursor proteins. Likely partners include cytosolic ribonucleoprotein organizers and mitochondrial targeting factors; transient associations with mitochondrial import receptors and RNA-binding assemblies would couple RNA fate to efficient precursor targeting.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N7F7.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N7F7"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N7F7/entry","atlas":"/p/Q8N7F7"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}