{"uniprot":"Q8N7Q2","gene":"CELF2-AS1","name":"Putative uncharacterized protein CELF2-AS1","organism":"Homo sapiens (Human)","status":"dark","length":184,"sequence":"MFCLLHLCFYLANFASSIKRTHAVNGCCGLQMIALWAQSSGNADARVEEILAGEERRLAALLGSQGMRFWVCLAACRAMWGLAARRGRAEDSSSSPVDASKFPWRGGQHRTTMMPCLLRVGVFRPCHVRPTGDPSCDVQPPRLGFSRVPDTQVAFYGSGHWDPTPFSVHSCFFNFQVRKIIFLL","function_summary":"A soluble human scaffold that accumulates in nuclear bodies and the nucleolus, where it assembles inhibitory complexes that suppress cell migration and invasion. By leveraging multivalent protein-binding capacity, it dampens the activity of matrix metalloproteinases and restrains invasion-related gene programs. Its nuclear localization enables coordination of transcriptional and RNA-processing pathways that converge on reduced protease output and decreased motility, consistent with a role as a negative regulator of invasion.","plain_language":"CELF2-AS1 has barely been studied. The model's best guess: A soluble human scaffold that accumulates in nuclear bodies and the nucleolus, where it assembles inhibitory complexes that suppress cell migration and invasion. By leveraging multivalent protein-binding capacity, it dampens the activity of matrix metalloproteinases and restrains invasion-related gene programs.","uniprot_summary":"Acts as a negative regulator of cell migration and invasion.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0030336","label":"negative regulation of cell migration"},{"id":"GO:0010951","label":"negative regulation of endopeptidase activity"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and no catalytic or transmembrane domains indicates a soluble adaptor/scaffold rather than an enzyme or transporter. Such architectures typically mediate selective macromolecular interactions through low-complexity or modular binding surfaces, which causally supports a primary molecular function of protein binding.\n\nFrom this binding-centric core, I infer higher-order roles by mapping the biological processes that this architecture enables. The protein is described as a negative regulator of cell migration and invasion, and its ability to inhibit MMP2 and MMP9 activity aligns with GO:0030336 negative regulation of cell migration and GO:0010951 negative regulation of endopeptidase activity. A binding-driven scaffold can directly sequester or spatially organize metalloproteinase complexes, reducing pericellular matrix degradation and thereby suppressing motility programs. The same binding capacity plausibly extends to transcriptional and RNA-processing assemblies that tune invasion-related gene expression.\n\nCellular localization sharpens this picture. The protein concentrates in nuclear substructures—nuclear bodies and the nucleolus—consistent with GO:0016604 nuclear body and with a broader nuclear residence. Nuclear bodies serve as hubs for transcription, splicing, and RNA surveillance; nucleolar residency often reflects roles in ribosome biogenesis and stress-responsive sequestration. A soluble, binding-competent scaffold that accumulates in nuclear bodies can modulate the availability and assembly of protease-regulatory factors and invasion-metastasis transcripts. This nuclear enrichment causally explains how the protein exerts transcriptional and post-transcriptional control over pathways that ultimately restrain MMP2/MMP9 activity and cell migratory behavior.\n\nMechanistically, I hypothesize that the protein assembles inhibitory complexes that curb metalloproteinase function and invasion signaling. By concentrating in nuclear bodies, it likely recruits transcriptional repressors and RNA-processing factors to dampen expression and maturation of pro-migratory genes, while directly binding MMP2/MMP9 to limit their activity. This dual nuclear-cytoplasmic buffering predicts reduced extracellular proteolysis and suppressed invasion. Likely interaction partners include MMP zymogens and their endogenous inhibitors, nuclear body constituents (such as PML and SP100), and nucleolar organizers; together these assemblies provide a coherent route from binding-driven scaffolding to suppression of migration and invasion.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N7Q2.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N7Q2"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N7Q2/entry","atlas":"/p/Q8N7Q2"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}