{"uniprot":"Q8N801","gene":"STPG4","name":"Protein STPG4","organism":"Homo sapiens (Human)","status":"dark","length":248,"sequence":"MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVDKDQSLQLSPGQYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSLFFNNNNWLLK","function_summary":"A human nucleoplasm-enriched adaptor that uses tandem PG-rich repeats to form a flexible scaffold for multivalent protein binding. By assembling and stabilizing signaling assemblies in the nucleoplasm and adjacent cytoplasm, it enhances kinase activity and coordinates phosphorylation-driven pathways linked to cytoskeletal and cell-cycle–adjacent regulation. Its low-complexity architecture supports dynamic complex formation rather than catalysis, consistent with a role in tuning nuclear-associated signaling circuits and transient perinuclear/cytoplasmic pools.","plain_language":"STPG4 has barely been studied. The model's best guess: A human nucleoplasm-enriched adaptor that uses tandem PG-rich repeats to form a flexible scaffold for multivalent protein binding. By assembling and stabilizing signaling assemblies in the nucleoplasm and adjacent cytoplasm, it enhances kinase activity and coordinates phosphorylation-driven pathways linked to cytoskeletal and cell-cycle–adjacent regulation.","uniprot_summary":"May be involved in kinase activity.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0033674","label":"positive regulation of kinase activity"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR010736","name":"Sperm-tail PG-rich repeat","type":"repeat","start":176,"end":202},{"id":"IPR010736","name":"Sperm-tail PG-rich repeat","type":"repeat","start":210,"end":237}],"reasoning":"I begin with the InterPro architecture. Two tandem low-complexity repeats characteristic of the sperm-tail PG-rich repeat region occur in the C-terminal half of the protein: IPR010736 (Sperm-tail PG-rich repeat, residues 176–202) followed by IPR010736 (Sperm-tail PG-rich repeat, residues 210–237). This arrangement creates a polymeric, proline/glycine-rich scaffold that favors multivalent protein–protein interactions rather than catalysis. The spacing and repetition of these PG-rich modules typically produce flexible binding platforms that concentrate signaling components and cytoskeletal or pericentriolar assemblies. Such an architecture causally supports a molecular function centered on GO:0005515 protein binding.\n\nFrom this scaffolded binding capacity, I infer a regulatory role in kinase signaling. The explicit phenotype—promotion of kinase activity—emerges naturally from a multivalent adaptor that stabilizes kinase–substrate encounters or recruits activating cofactors. This mechanistic role aligns with GO:0033674 positive regulation of kinase activity and explains how the protein can tune pathways that govern cytoskeletal dynamics and cell-cycle–linked signaling. The PG-rich repeats provide the avidity and spatial control needed to enhance phosphorylation cascades without directly encoding catalytic motifs.\n\nCellular placement follows from both the domain logic and the observed distribution. A soluble, repeat-rich scaffold is consistent with nucleoplasmic residency and cytoplasmic pools. The reported nucleoplasm localization maps to GO:0005654 nucleoplasm and explains how the protein can modulate nuclear-associated kinase pathways and transcriptional regulators. Additional cytoplasmic and perinuclear pools are coherent with a nucleoplasm–cytoplasm shuttling adaptor that assembles signaling complexes near the nuclear envelope and centrosome.\n\nIntegrating these lines, I propose a mechanism in which the PG-rich repeat array nucleates transient assemblies that potentiate kinase signaling in the nucleoplasm and adjacent cytoplasm. By concentrating kinases and their substrates, the protein enhances phosphorylation throughput and timing. Likely partners include nuclear-localized kinase modules (e.g., CDK-associated complexes), nuclear transport machinery that gates nucleoplasmic access, and pericentriolar scaffolds that couple kinase signaling to cytoskeletal organization. This adaptor-driven assembly provides a parsimonious explanation for its binding-centric molecular function, its positive regulation of kinase activity, and its nucleoplasmic and cytoplasmic distribution.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N801.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N801"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N801/entry","atlas":"/p/Q8N801"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}