{"uniprot":"Q8N8G6","gene":"C15orf54","name":"Putative uncharacterized protein C15orf54","organism":"Homo sapiens (Human)","status":"dark","length":183,"sequence":"MEVKFITGKHGGRRPQRAEPQRICRALWLTPWPSLILKLLSWIILSNLFLHLRATHHMTELPLRFLYIALSEMTFREQTSHQIIQQMSLSNKLEQNQLYGEVINKETDNPVISSGLTLLFAQKPQSPGWKNMSSTKRVCTILADSCRAQAHAADRGERGHFGVQILHHFIEVFNVMAVRSNPF","function_summary":"A soluble human adaptor that concentrates in nuclear bodies and uses multivalent protein binding to restrain kinase output. By assembling and positioning regulatory partners within subnuclear condensates, it dampens the activity of a major cyclin-dependent kinase and thereby attenuates nuclear phosphorylation cascades that govern chromatin and transcriptional programs.","plain_language":"C15orf54 has barely been studied. The model's best guess: A soluble human adaptor that concentrates in nuclear bodies and uses multivalent protein binding to restrain kinase output. By assembling and positioning regulatory partners within subnuclear condensates, it dampens the activity of a major cyclin-dependent kinase and thereby attenuates nuclear phosphorylation cascades that govern chromatin and transcriptional programs.","uniprot_summary":"May inhibit the activity of CKII.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006469","label":"negative regulation of protein kinase activity"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of only a generic protein-binding signature and no catalytic or transmembrane domains indicates a soluble adaptor/scaffold rather than an enzyme or transporter. Such architectures typically mediate selective macromolecular interactions through low-complexity or modular binding surfaces.\n\nFrom this binding-centric core, the most direct molecular function is protein binding (GO:0005515). A binding scaffold of this kind can exert regulatory control by docking kinases and their regulators. The biological role is clarified by the process label GO:0006469 negative regulation of protein kinase activity. A non-enzymatic binder that suppresses kinase output most parsimoniously acts by sequestration, occlusion of activation surfaces, or recruitment of inhibitory partners. The stated role in restraining the activity of the cyclin-dependent kinase CK2 fits this logic: a binding platform that limits CK2 catalytic throughput will attenuate downstream phosphorylation cascades.\n\nCellular context further constrains mechanism. Localization to GO:0016604 nuclear body points to subnuclear condensates (e.g., PML bodies) that concentrate signaling and transcriptional regulators. Nuclear bodies create high local concentrations of post-translationally modified proteins and provide reaction chambers for signal attenuation. A nuclear body–resident kinase inhibitor can locally buffer kinase activity by transiently trapping CK2 and its substrates, thereby shaping nuclear phosphorylation circuits.\n\nIntegrating these lines of evidence yields a coherent mechanism: a soluble, nuclear body–associated scaffold that binds proteins and dampens kinase activity. By concentrating in nuclear bodies, it likely modulates the phosphorylation state of chromatin-associated factors and transcriptional machinery. This architecture causes inhibition of CK2 through multivalent binding that either masks active-site accessibility or recruits inhibitory complexes, thereby enacting negative regulation of protein kinase activity.\n\nGiven this mechanism and location, plausible interaction partners include CK2 holoenzyme components and nuclear body constituents. I hypothesize transient assemblies with cyclin-dependent kinases and their regulators, PML-body scaffolds, and SUMO/ubiquitin pathway adaptors that tune nuclear condensate composition. These interactions would collectively restrain CK2-dependent phosphorylation within the nucleus.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N8G6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N8G6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N8G6/entry","atlas":"/p/Q8N8G6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}