{"uniprot":"Q8N9N8","gene":"EIF1AD","name":"Probable RNA-binding protein EIF1AD","organism":"Homo sapiens (Human)","status":"dark","length":165,"sequence":"MSQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA","function_summary":"A soluble RNA-binding assembly factor that shuttles between nucleolus and cytosol. It uses an OB-fold/S1-type RNA-binding core to scaffold initiation factor cohorts and ribonucleoprotein assemblies. In the nucleolus, it engages rRNA biogenesis pathways that accompany transcription and processing of ribosomal RNA, while in the cytosol it supports formation and regulation of translation initiation complexes. This shuttling behavior ties ribosome production to initiation, aligning nucleolar rRNA handling with cytoplasmic translation.","plain_language":"EIF1AD has barely been studied. The model's best guess: A soluble RNA-binding assembly factor that shuttles between nucleolus and cytosol. It uses an OB-fold/S1-type RNA-binding core to scaffold initiation factor cohorts and ribonucleoprotein assemblies.","uniprot_summary":"May be involved in translation initiation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0009303","label":"rRNA transcription"}],"cellular_component":[{"id":"GO:0005829","label":"cytosol"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR012340","name":"Nucleic acid-binding, OB-fold","type":"homologous_superfamily","start":1,"end":142},{"id":"IPR006196","name":"RNA-binding domain, S1, IF1 type","type":"domain","start":5,"end":108},{"id":"IPR039294","name":"Probable RNA-binding protein EIF1AD","type":"family","start":1,"end":163},{"id":"IPR001253","name":"Translation initiation factor 1A (eIF-1A)","type":"family","start":20,"end":103}],"reasoning":"I begin with the InterPro architecture. The polypeptide is dominated by IPR012340 (Nucleic acid-binding, OB-fold homologous superfamily, residues 1–142), a classical β-barrel fold that creates a curved, positively charged surface for single-stranded nucleic acid recognition and for docking onto ribosomal RNA/protein interfaces. Nested within this OB scaffold sits IPR006196 (RNA-binding domain, S1, IF1 type, residues 5–108), a soluble RNA-binding module that stabilizes RNA–protein assemblies and often mediates interactions with translational machinery. The core of the S1 module overlaps IPR001253 (Translation initiation factor 1A family, residues 20–103), indicating an eIF1A-like surface that typically engages the small ribosomal subunit and pre-initiation complexes. The full-length sequence is encompassed by IPR039294 (Probable RNA-binding protein EIF1AD family, residues 1–163), which specifies a eukaryotic initiation factor–related RNA-binding lineage. The ordered layout—an N-terminal OB-fold superfamily framework carrying an internal S1/IF1-type RNA-binding core—causes high-affinity RNA and ribosome-proximal binding and favors assembly with other proteins through multivalent surfaces.\n\nFrom this architecture, the primary molecular function resolves as protein binding (GO:0005515). The OB-fold and S1/IF1-type core provide extensive interfaces for assembling initiation complexes and ribonucleoproteins; these surfaces are optimized for transient, multivalent contacts rather than catalysis. Such multivalency explains how the protein scaffolds initiation factor cohorts and small-subunit components.\n\nThis binding-centric mechanism naturally feeds into two connected biological processes. First, the OB/S1 module is a hallmark of translation initiation factor pathways; thus it supports assembly and regulation of initiation complexes that license start-codon selection and ribosome joining. Second, the same RNA-binding architecture is well-suited to nucleolar pathways where rRNA is transcribed and processed. By stabilizing nascent rRNA–protein assemblies and coordinating with ribosome biogenesis factors, the protein contributes to rRNA transcription (GO:0009303) and its downstream maturation pipeline. The coupling of initiation factor ancestry with nucleolar residency provides a mechanistic bridge: nucleolar engagement during rRNA biogenesis informs cytosolic translation capacity.\n\nCellular localization follows directly from these roles. The soluble OB/S1 architecture and absence of transmembrane features place the protein in the cytosol (GO:0005829), where initiation complexes form. Its participation in ribosome biogenesis and rRNA handling requires nucleolar residency, consistent with nucleolar accumulation and supporting evidence for nucleoplasmic presence (GO:0005654). Thus, the protein shuttles between nucleolus and nucleoplasm for rRNA-related assembly and the cytosol for initiation-complex function.\n\nMechanistically, I hypothesize that the OB-fold buttresses an eIF1A-like RNA-binding platform that recruits initiation factors and small-subunit ribosomal proteins to choreograph start-site selection and ribosome joining. In the nucleolus, the same platform likely binds pre-ribosomal particles and transiently modulates rRNA transcription/processing assemblies. Likely interaction partners include small-subunit ribosomal proteins and initiation factors that form the pre-initiation complex, as well as nucleolar rRNA biogenesis factors. This dual-compartment itinerary—nucleolus to cytosol—positions the protein as a coordinator that links rRNA supply with translational initiation demand.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8N9N8.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8N9N8"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8N9N8/entry","atlas":"/p/Q8N9N8"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}