{"uniprot":"Q8NA92","gene":"THAP8","name":"THAP domain-containing protein 8","organism":"Homo sapiens (Human)","status":"dark","length":274,"sequence":"MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPSCFQWRWGVRYLRPDAVPSIFSRGPPAKSQRRTRSTQKPVSPPPPLQKNTPLPQSPAIPVSGPVRLVVLGPTSGSPKTVATMLLTPLAPAPTPERSQPEVPAQQAQTGLGPVLGALQRRVRRLQRCQERHQAQLQALERLAQQLHGESLLARARRGLQRLTTAQTLGPEESQTFTIICGGPDIAMVLAQDPAPATVDAKPELLDTRIPSA","function_summary":"A nuclear chromatin-associated regulator that uses an N-terminal THAP-type zinc finger to anchor onto chromatin and assemble repressive complexes. By acting as a multivalent adaptor, it recruits corepressor machinery in the nucleoplasm to dampen RNA polymerase II transcription, thereby shaping gene-expression programs through stable association with chromatin and transcriptional regulators.","plain_language":"THAP8 has barely been studied. The model's best guess: A nuclear chromatin-associated regulator that uses an N-terminal THAP-type zinc finger to anchor onto chromatin and assemble repressive complexes. By acting as a multivalent adaptor, it recruits corepressor machinery in the nucleoplasm to dampen RNA polymerase II transcription, thereby shaping gene-expression programs through stable association with chromatin and transcriptional regulators.","uniprot_summary":"May be involved in transcriptional regulation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0000122","label":"negative regulation of transcription by RNA polymerase II"}],"cellular_component":[{"id":"GO:0000785","label":"chromatin"},{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[{"id":"IPR006612","name":"THAP-type zinc finger","type":"domain","start":1,"end":91},{"id":"IPR052224","name":"THAP domain-containing protein","type":"family","start":1,"end":151}],"reasoning":"I begin with the InterPro architecture. The N-terminus harbors IPR006612 (THAP-type zinc finger, residues 1–91), a C2CH zinc-coordinating module that forms a compact DNA- and chromatin-binding fold frequently used by transcriptional regulators. This domain sits within a broader N-terminal family signature, IPR052224 (THAP domain-containing protein, residues 1–151), which marks proteins that employ the THAP module as a nucleic-acid recognition and assembly hub. The ordered layout—an N-terminal THAP zinc finger followed by extended family region—creates a bipartite platform: the THAP core confers sequence- and context-dependent chromatin engagement, while the flanking family region provides surfaces for recruiting cofactors. This architecture causes a non-enzymatic, adaptor-like behavior that relies on multivalent contacts with other macromolecules, aligning with GO:0005515 protein binding as the primary molecular function.\n\nFrom this binding-centric scaffold, the most direct consequence is transcriptional repression. THAP modules often tether corepressor machineries to chromatin, and the absence of catalytic motifs together with a chromatin-anchoring fold points to assembly of repression complexes rather than enzymatic chromatin modification. This mechanistic role maps to GO:0000122 negative regulation of transcription by RNA polymerase II: by docking onto chromatin and recruiting repressors, the protein reduces Pol II-driven transcriptional output.\n\nCellular localization follows from the same architecture. A THAP zinc finger dictates nuclear chromatin association, and the lack of transmembrane segments or secretion signals supports a soluble nuclear role. The chromatin-binding propensity and repressor function place the protein in the GO:0000785 chromatin compartment and within the GO:0005654 nucleoplasm, consistent with a nuclear residency where transcriptional regulation is executed.\n\nMechanistically, I hypothesize that the THAP domain nucleates a repressive hub that reads chromatin features and stabilizes assemblies of histone deacetylases and Polycomb-associated factors. The THAP core likely anchors to specific genomic loci or chromatin states, while the family region recruits corepressors to consolidate silencing. In this model, the protein functions as a nuclear adaptor that bridges chromatin to repression machinery, fine-tuning Pol II transcription.\n\nThis reasoning suggests likely interaction partners: chromatin-modifying complexes (e.g., HDAC-containing assemblies), ATP-dependent remodelers, and sequence-specific transcription factors that provide locus targeting. Such partners would cooperate to establish and maintain repressed chromatin domains in the nucleoplasm and at chromatin interfaces.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NA92.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NA92"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NA92/entry","atlas":"/p/Q8NA92"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}