{"uniprot":"Q8NDY4","gene":"MDS2","name":"Myelodysplastic syndrome 2 translocation-associated protein","organism":"Homo sapiens (Human)","status":"dark","length":140,"sequence":"MLQAADFIERTETAGELSRGLIGVLSSQISWCLLNVNLSKLPTRLQRLSCSVLNSSPAMRGGARGRPQLTLERPLRPGCRLHSCSEAEKGGFVRRKEIILFPPCEDPARGWLSANPGREPSPGICWHLNLGLPSLHNCEE","function_summary":"A soluble nuclear adaptor that organizes protein assemblies required for accurate chromosome handling. By using multivalent binding surfaces, it scaffolds chromosome-segregation machinery within the nucleoplasm, coordinating chromatin architecture and checkpoint pathways to ensure faithful partitioning of chromosomes during cell division.","plain_language":"MDS2 has barely been studied. The model's best guess: A soluble nuclear adaptor that organizes protein assemblies required for accurate chromosome handling. By using multivalent binding surfaces, it scaffolds chromosome-segregation machinery within the nucleoplasm, coordinating chromatin architecture and checkpoint pathways to ensure faithful partitioning of chromosomes during cell division.","uniprot_summary":"May be involved in chromosome segregation.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0051983","label":"regulation of chromosome segregation"}],"cellular_component":[{"id":"GO:0005654","label":"nucleoplasm"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: GO:0005515 protein binding. The presence of a sole, non-catalytic binding annotation and the absence of enzymatic or transmembrane signatures indicate a soluble adaptor or scaffold that organizes other proteins rather than catalyzing reactions. Such architectures typically mediate multivalent interactions that stabilize higher-order assemblies.\n\nFrom this binding-centric core, the most direct molecular function is protein binding (GO:0005515). A binding scaffold of this kind can nucleate complexes that govern chromosome dynamics. The biological role aligns with regulation of chromosome segregation (GO:0051983). A non-enzymatic assembly factor situated in chromosome maintenance pathways would influence kinetochore-microtubule attachment, cohesion resolution, and checkpoint signaling—processes that collectively ensure accurate segregation.\n\nCellular localization follows from function and solubility. The lack of membrane features and the role in chromosome handling point to a nuclear soluble pool, consistent with nucleoplasm (GO:0005654). Operating within the nucleoplasm allows the protein to coordinate with chromosome condensation, cohesion, and spindle assembly pathways before and during mitosis.\n\nMechanistically, a nucleoplasmic binding scaffold can couple chromosome structural modules to surveillance systems. By concentrating binding interfaces, it can recruit and position chromosome-associated complexes—such as cohesin regulators and kinetochore adaptors—to modulate segregation fidelity. I hypothesize that it transiently associates with nucleoplasmic assemblies controlling chromosome architecture and checkpoint pathways, forming regulated hubs that tune the timing and fidelity of segregation.\n\nThis model predicts interaction partners that manage chromosome topology and fidelity: cohesin/condensin assemblies and their loaders/unloaders; kinetochore adaptors; and checkpoint mediators. These associations would allow the scaffold to sense and relay assembly states, thereby stabilizing segregation-competent chromatin and coordinating with mitotic machinery.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NDY4.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NDY4"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NDY4/entry","atlas":"/p/Q8NDY4"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}