{"uniprot":"Q8NEQ5","gene":"C1orf162","name":"Transmembrane protein C1orf162","organism":"Homo sapiens (Human)","status":"dark","length":155,"sequence":"MGGNGSTCKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVLLTLLLIAFIFLIIKSYRKYRRERLPISPGPLLRWVPLLSGTMADHSKPQAPDPHSDPPAKLSSIPGESLTYASTTFKLSEEKSNHLAENHSADFDPIVYAQIKVTN","function_summary":"A conserved human multi-pass membrane protein that resides predominantly in the endoplasmic reticulum, where it acts as a membrane-embedded scaffold to organize intracellular signaling assemblies. By mediating protein–protein interactions rather than catalysis, it helps tune the strength and timing of signaling pathways and is also incorporated into extracellular vesicles, linking ER-centered signal control with exosome-mediated communication.","plain_language":"C1orf162 has barely been studied. The model's best guess: A conserved human multi-pass membrane protein that resides predominantly in the endoplasmic reticulum, where it acts as a membrane-embedded scaffold to organize intracellular signaling assemblies. By mediating protein–protein interactions rather than catalysis, it helps tune the strength and timing of signaling pathways and is also incorporated into extracellular vesicles, linking ER-centered signal control with exosome-mediated communication.","uniprot_summary":"May be involved in signal transduction.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0035556","label":"intracellular signal transduction"}],"cellular_component":[{"id":"GO:0070062","label":"extracellular exosome"}]},"interpro":[{"id":"IPR037763","name":"Transmembrane protein C1orf162","type":"family","start":9,"end":155}],"reasoning":"I begin with the InterPro architecture: IPR037763 (Transmembrane protein C1orf162 family) spans residues 9–155, covering essentially the entire polypeptide and defining a compact, multi-pass membrane module. A family-level signature that blankets the sequence indicates a conserved membrane-embedded scaffold rather than an enzyme. The absence of catalytic domains and the dominance of transmembrane architecture causally point to a role in assembling or modulating signaling complexes through direct protein–protein interactions, consistent with GO:0005515 protein binding as the primary molecular function.\n\nA multi-pass membrane scaffold situated in intracellular membranes is well suited to regulate signaling flux rather than perform chemistry. By organizing receptor-proximal or endomembrane signaling nodes, such a scaffold drives intracellular information flow, aligning with GO:0035556 intracellular signal transduction. The family signature’s breadth and the experimentally observed endoplasmic reticulum (ER) membrane residency together argue that the protein shapes signal propagation at the ER–plasma membrane–endosome axis, where many signaling pathways originate and are routed through trafficking and vesicle-mediated communication.\n\nCellular localization follows directly from the architecture and annotations. A multi-pass topology dictates membrane embedding; the experimentally observed residence in the endoplasmic reticulum membrane supports assignment to the ER and to integral membrane fractions. The presence in extracellular exosomes (GO:0070062) can be mechanistically reconciled: ER-derived membrane proteins are frequently incorporated into intraluminal vesicles and subsequently secreted as exosomes. Thus, ER residency explains both the core function and the exosomal detection.\n\nMechanistically, I hypothesize that this protein forms a membrane-integrated platform that binds signaling adaptors and receptors to tune pathway throughput. In the ER, it likely nucleates assemblies that influence receptor maturation, trafficking, or downstream cascade activation. By stabilizing or recruiting kinases, adaptors, and small GTPases, it modulates signal amplitude and timing. Its inclusion in exosomes suggests a second layer of regulation: packaging of the membrane scaffold into vesicles enables non-cell-autonomous modulation of recipient-cell signaling.\n\nFrom these lines of evidence, I infer a model in which a conserved, multi-pass ER membrane scaffold executes protein binding to assemble intracellular signal-transduction complexes, thereby controlling pathway routing and contributing to exosome-mediated intercellular communication. Likely interaction partners include ER-resident chaperones and coat machinery that govern trafficking, as well as cytosolic adaptors that couple membrane events to kinase cascades.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NEQ5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NEQ5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NEQ5/entry","atlas":"/p/Q8NEQ5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}