{"uniprot":"Q8NFP0","gene":"PXT1","name":"Peroxisomal testis-specific protein 1","organism":"Homo sapiens (Human)","status":"dark","length":134,"sequence":"MKKKHDGIVYETKEVLNPSPKVTHCCKSLWLKYSFQKAYMTQLVSSQPVPAMSRNPDHNLLSQPKEHSIVQKHHQEEIIHKLAMQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHLL","function_summary":"A small, soluble adaptor that concentrates near peroxisomes and uses multivalent binding to assemble regulatory complexes that tune germ-cell apoptosis. By organizing peroxisome-associated assemblies and coupling metabolic and oxidative cues to cell-fate pathways, it promotes the initiation of apoptotic signaling and facilitates downstream activation of caspase activity within higher-order protein complexes.","plain_language":"PXT1 has barely been studied. The model's best guess: A small, soluble adaptor that concentrates near peroxisomes and uses multivalent binding to assemble regulatory complexes that tune germ-cell apoptosis. By organizing peroxisome-associated assemblies and coupling metabolic and oxidative cues to cell-fate pathways, it promotes the initiation of apoptotic signaling and facilitates downstream activation of caspase activity within higher-order protein complexes.","uniprot_summary":"May be involved in apoptosis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0006915","label":"apoptotic process"},{"id":"GO:0043065","label":"positive regulation of apoptotic process"},{"id":"GO:0006919","label":"activation of cysteine-type endopeptidase activity involved in apoptotic process"}],"cellular_component":[{"id":"GO:0032991","label":"protein-containing complex"}]},"interpro":[{"id":"IPR029186","name":"Peroxisomal testis-specific protein 1","type":"family","start":1,"end":134}],"reasoning":"I begin with the InterPro architecture: IPR029186 (Peroxisomal testis-specific protein 1 family) spans residues 1–134 and covers the entire polypeptide. A single, full-length family signature without embedded catalytic domains indicates a small, non-enzymatic protein specialized for tissue- and organelle-associated roles. The peroxisomal annotation of this family suggests an N-terminal or internal targeting propensity and a soluble matrix/associated role rather than membrane catalysis. Such compact, organelle-tethered adaptors typically function through multivalent contacts, which causally supports a binding-centric molecular role consistent with GO:0005515 protein binding.\n\nFrom this binding-centric foundation, I infer function by considering how a peroxisome-associated, testis-enriched adaptor could influence cell fate. Peroxisomes coordinate lipid metabolism and reactive oxygen species handling in germ cells; shifts in these pathways modulate apoptosis thresholds. A scaffold that assembles or tunes peroxisome-centered complexes can bias the cell toward programmed cell death. This causal chain aligns with GO:0006915 apoptotic process and specifically with GO:0043065 positive regulation of apoptotic process. Moreover, peroxisome-derived signals and cytochrome c release can feed into caspase activation cascades; thus the adaptor’s assembly role can facilitate GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process by promoting the upstream events that trigger caspase activation.\n\nCellular context follows from the soluble adaptor nature and complex assembly behavior. The absence of catalytic cores and the presence of a family-wide binding role point to participation in higher-order assemblies, matching GO:0032991 protein-containing complex. Peroxisomal residency inferred from the family signature places the protein in or near the peroxisome, where it can nucleate complexes that couple metabolic status to apoptotic signaling.\n\nMechanistically, I hypothesize that this protein acts as a peroxisome-proximal scaffold that senses or relays metabolic/apoptotic cues in germ cells. By binding partners, it likely organizes peroxisomal matrix or membrane-associated modules and couples them to cytosolic apoptotic machinery. This assembly could enhance cytochrome c mobilization and caspase-9 activation indirectly through peroxisome-dependent ROS and lipid signals. Likely interaction partners include peroxisomal import and matrix factors (such as PEX5 and PEX14), oxidative metabolism enzymes (e.g., acyl-CoA oxidase complexes), and apoptosis regulators (e.g., BAX/BCL2 family, cytochrome c, and APAF-1), providing a route from peroxisomal status to caspase cascade initiation.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NFP0.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NFP0"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NFP0/entry","atlas":"/p/Q8NFP0"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}