{"uniprot":"Q8NFR3","gene":"SPTSSB","name":"Serine palmitoyltransferase small subunit B","organism":"Homo sapiens (Human)","status":"dark","length":76,"sequence":"MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLAWEFFSKICGYHSTISN","function_summary":"A membrane-associated regulatory subunit that assembles and stabilizes the serine palmitoyltransferase complex at the endoplasmic reticulum, where it initiates sphingolipid formation by enabling the condensation of serine and palmitoyl-CoA. It achieves this by mediating multivalent protein interactions that optimize the catalytic core’s activity and substrate handling, thereby controlling flux into sphingolipid and downstream sphingosine biosynthesis pathways at the ER membrane.","plain_language":"SPTSSB has barely been studied. The model's best guess: A membrane-associated regulatory subunit that assembles and stabilizes the serine palmitoyltransferase complex at the endoplasmic reticulum, where it initiates sphingolipid formation by enabling the condensation of serine and palmitoyl-CoA. It achieves this by mediating multivalent protein interactions that optimize the catalytic core’s activity and substrate handling, thereby controlling flux into sphingolipid and downstream sphingosine biosynthesis pathways at the ER membrane.","uniprot_summary":"Part of a complex catalyzing the first committed step in sphingolipid biosynthesis, the condensation of serine with palmitoyl-CoA to form sphing-4-enine long chain base (Probable).","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"},{"id":"GO:0016409","label":"palmitoyltransferase activity"}],"biological_process":[{"id":"GO:0030148","label":"sphingolipid biosynthetic process"},{"id":"GO:0046512","label":"sphingosine biosynthetic process"}],"cellular_component":[{"id":"GO:0017059","label":"serine C-palmitoyltransferase complex"},{"id":"GO:0005789","label":"endoplasmic reticulum membrane"}]},"interpro":[{"id":"IPR024512","name":"Small subunit of serine palmitoyltransferase-like","type":"family","start":7,"end":59}],"reasoning":"I begin with the InterPro architecture: a single annotated region, IPR024512 (Small subunit of serine palmitoyltransferase-like family) spanning residues 7–59. This compact signature marks the small regulatory subunit that associates with the serine palmitoyltransferase (SPT) core. Its N-terminal concentration of the family-defining motif and the absence of catalytic acyltransferase motifs indicate a non-catalytic role that stabilizes and modulates the larger enzymatic subunit rather than performing chemistry itself. The short length and family assignment together argue for a membrane-associated adaptor that tunes enzyme assembly and specificity.\n\nFrom this architecture, the molecular function resolves into two complementary activities. First, the small subunit’s primary role is multivalent association with its catalytic partner and other assembly factors, which necessitates GO:0005515 protein binding. Second, although the small subunit is non-catalytic, its obligatory participation in the active SPT holoenzyme—which performs the condensation of serine and palmitoyl-CoA—places it within a system that executes GO:0016409 palmitoyltransferase activity. The regulatory subunit’s presence is causally required to achieve full enzymatic throughput and substrate channeling in vivo.\n\nThis enzymatic module initiates sphingolipid formation by producing the long-chain base that feeds forward into ceramide and sphingosine pathways. Consequently, the protein’s action propagates into GO:0030148 sphingolipid biosynthetic process. By controlling flux at the pathway’s entry point, it indirectly drives GO:0046512 sphingosine biosynthetic process, because sphingosine arises downstream from the same metabolic stream. The small subunit’s modulation of the catalytic core thereby governs both membrane sphingolipid and signaling sphingolipid pools.\n\nCellular localization follows from the assembly and membrane-embedded nature of SPT. The annotated family and the requirement for lipid-substrate access dictate residence at the endoplasmic reticulum membrane, consistent with GO:0005789 endoplasmic reticulum membrane. There, the small subunit forms part of the GO:0017059 serine C-palmitoyltransferase complex. Its membrane-proximal adaptor role ensures the catalytic subunit is properly positioned and stabilized within the bilayer.\n\nMechanistically, the small subunit acts as a membrane-tethered assembly factor that enhances catalytic efficiency and substrate preference of the SPT core. By binding and stabilizing the larger acyltransferase, it likely shapes the local membrane environment and acyl-CoA/serine access routes, biasing product profiles toward physiologically required long-chain bases. I hypothesize that it nucleates a transient complex with the catalytic SPT subunit and accessory regulators at ER subdomains enriched in sphingolipid synthesis. Candidate partners include other SPT-complex components and ER-resident lipid-handling proteins that together coordinate sphingolipid initiation and handoff to downstream pathways.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NFR3.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NFR3"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NFR3/entry","atlas":"/p/Q8NFR3"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}