{"uniprot":"Q8NHW6","gene":"OTOS","name":"Otospiralin","organism":"Homo sapiens (Human)","status":"dark","length":89,"sequence":"MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED","function_summary":"A small secreted human protein that operates outside cells to support hearing. Its compact extracellular architecture favors selective binding to matrix and cell-surface assemblies in the cochlea, where it likely stabilizes the local environment required for auditory transduction and signaling. By organizing and buffering interactions among extracellular components and receptors, it helps maintain the structural and functional conditions that underpin sound perception.","plain_language":"OTOS has barely been studied. The model's best guess: A small secreted human protein that operates outside cells to support hearing. Its compact extracellular architecture favors selective binding to matrix and cell-surface assemblies in the cochlea, where it likely stabilizes the local environment required for auditory transduction and signaling.","uniprot_summary":"Involved in hearing.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007605","label":"sensory perception of sound"}],"cellular_component":[{"id":"GO:0005576","label":"extracellular region"}]},"interpro":[{"id":"IPR028224","name":"Otospiralin","type":"family","start":1,"end":89}],"reasoning":"I begin with the InterPro architecture: IPR028224 (Otospiralin family) spans residues 1–89 and covers the entire polypeptide, indicating a compact, single-domain secreted protein specialized for a restricted biological niche rather than a modular enzyme. Family-level signatures of otospiralin typically denote small, secreted cochlear factors that act as extracellular binders rather than catalysts. The absence of catalytic or transmembrane domains and the full-length coverage of a single family profile together argue that this architecture creates a soluble binding module tuned to extracellular interactions.\n\nFrom this architecture, the most direct molecular function is protein binding (GO:0005515). A small, secreted, single-domain fold that lacks enzymatic motifs but is conserved in auditory tissues implies avid, selective adhesion to extracellular partners—likely matrix components and cell-surface receptors—rather than enzymatic chemistry. Such binding capacity in the extracellular milieu is consistent with organizing or stabilizing cochlear microenvironments.\n\nThis binding role causally links to sensory perception of sound (GO:0007605). By shaping extracellular interactions in the cochlea, a secreted otospiralin-family binder can stabilize the architecture and signaling milieu required for hair-cell function and synaptic transmission. Disruption would propagate as altered matrix cohesion or receptor presentation, directly impacting auditory pathway fidelity.\n\nThe cellular component is inferred as extracellular region (GO:0005576), which aligns with a secreted signal. The experimentally supported secreted nature places the protein outside cells, where it can scaffold or chaperone interactions among extracellular matrix and surface receptors in the inner ear. This extracellular residency is a direct consequence of the otospiralin family architecture and inferred secretion.\n\nMechanistically, I hypothesize that the protein is a soluble organizer that binds to cochlear extracellular components and cell-surface complexes to maintain the structural and signaling integrity necessary for hearing. Likely partners include matrix proteins and adhesion systems that define cochlear compartments and synaptic interfaces. By transiently clustering or stabilizing these assemblies, the protein tunes the physical and biochemical environment that supports auditory transduction and downstream signaling.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8NHW6.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8NHW6"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8NHW6/entry","atlas":"/p/Q8NHW6"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}