{"uniprot":"Q8TBR5","gene":"CIRBP-AS1","name":"Putative uncharacterized protein CIRBP-AS1","organism":"Homo sapiens (Human)","status":"dark","length":109,"sequence":"MAPEVIRQDFQAGEVAFRRTGYLRGRSVLTQTKHSLAGNGRHPVALRTRLGSLALGAVPTWTKLWAQSTTWQTRNHTRTGHAYPRFTRPSFPSCNRNGKRRKLRLGLPY","function_summary":"A soluble nuclear scaffold that concentrates in nuclear bodies and the nucleolus to modulate signaling-dependent transcription. By using multivalent protein binding, it assembles and tunes nuclear complexes that govern responses downstream of transforming growth factor beta receptors. Its nucleolar residency and nuclear enrichment position it to sequester and redistribute pathway effectors, thereby adjusting transcriptional outputs without direct catalytic activity.","plain_language":"CIRBP-AS1 has barely been studied. The model's best guess: A soluble nuclear scaffold that concentrates in nuclear bodies and the nucleolus to modulate signaling-dependent transcription. By using multivalent protein binding, it assembles and tunes nuclear complexes that govern responses downstream of transforming growth factor beta receptors.","uniprot_summary":"May be involved in TGF-beta signaling.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0017015","label":"regulation of transforming growth factor beta receptor signaling pathway"}],"cellular_component":[{"id":"GO:0016604","label":"nuclear body"},{"id":"GO:0005730","label":"nucleolus"}]},"interpro":[],"reasoning":"I begin with the InterPro architecture. The sequence carries a single annotated module: InterPro: GO:0005515 protein binding. This generic binding signature appears as the dominant feature of the polypeptide and, together with the experimentally observed nuclear and nucleolar localization, indicates a soluble adaptor/scaffold rather than an enzyme or transmembrane transporter. The absence of catalytic or membrane-anchoring domains and the presence of a broad protein-binding signature causally point to a role in assembling or modulating nuclear protein complexes.\n\nFrom this binding-centric architecture, the most direct molecular function is protein binding (GO:0005515). A binding scaffold in the nucleus can tune signaling outputs by sequestering transcriptional regulators or pathway mediators. The biological process label that best captures this role is regulation of transforming growth factor beta receptor signaling pathway (GO:0017015). TGF-beta signaling culminates in nuclear SMAD complexes that control transcription; a nuclear/nucleolar adaptor can regulate this pathway by altering SMAD availability, promoter occupancy, or chromatin-associated assemblies.\n\nCellular localization sharpens the mechanism. The protein resides in the nucleus and nucleolus and is further concentrated in nuclear bodies (GO:0016604). Nuclear bodies serve as hubs for post-transcriptional control and transcriptional modulation. Nucleolar residence (GO:0005730) suggests transient engagement with ribosome biogenesis and nucleolar sequestration pathways that frequently intersect with signaling-responsive transcriptional programs. This spatial arrangement causes pathway regulation by physically organizing nuclear complexes and gating access to target genes.\n\nIntegrating these observations, I infer a mechanism in which the protein functions as a nuclear/nucleolar scaffold that binds pathway components to modulate TGF-beta signaling outputs. By concentrating in nuclear bodies and the nucleolus, it likely buffers or redistributes SMAD-containing assemblies, thereby tuning transcriptional responses. This spatial control explains its role in regulating TGF-beta receptor signaling and its experimentally observed nuclear/nucleolar residency.\n\nGiven this model, the most plausible interaction partners are nuclear SMAD complexes and their cofactors, as well as nucleolar and nuclear-body organizers. I hypothesize transient associations with SMAD2/SMAD3 and the co-SMAD, along with transcriptional co-regulators and chromatin-associated factors. Such assemblies would allow the scaffold to fine-tune signaling-dependent transcription within nuclear compartments.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8TBR5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8TBR5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8TBR5/entry","atlas":"/p/Q8TBR5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}