{"uniprot":"Q8WUE5","gene":"CT55","name":"Cancer/testis antigen 55","organism":"Homo sapiens (Human)","status":"dark","length":264,"sequence":"MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEVCITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVHKSSSGFQDDGGLGRPKRERRSQSI","function_summary":"A cytoplasmic RNA–protein scaffold that uses an OB-fold core and a CT antigen-like interaction module to bind nucleic acids and assemble effector complexes controlling mRNA fate during germ cell differentiation. By organizing ribonucleoprotein assemblies and coupling them to cytoplasmic and Golgi-proximal pathways, it fine-tunes transcript utilization and decay essential for spermatid maturation.","plain_language":"CT55 has barely been studied. The model's best guess: A cytoplasmic RNA–protein scaffold that uses an OB-fold core and a CT antigen-like interaction module to bind nucleic acids and assemble effector complexes controlling mRNA fate during germ cell differentiation. By organizing ribonucleoprotein assemblies and coupling them to cytoplasmic and Golgi-proximal pathways, it fine-tunes transcript utilization and decay essential for spermatid maturation.","uniprot_summary":"May be involved in spermatogenesis.","go_terms":{"molecular_function":[{"id":"GO:0005515","label":"protein binding"}],"biological_process":[{"id":"GO:0007286","label":"spermatid development"}],"cellular_component":[{"id":"GO:0005737","label":"cytoplasm"},{"id":"GO:0005794","label":"Golgi apparatus"}]},"interpro":[{"id":"IPR012340","name":"Nucleic acid-binding, OB-fold","type":"homologous_superfamily","start":36,"end":99},{"id":"IPR063973","name":"RNA helicase Mov10l1-like, N-terminal OB domain","type":"domain","start":18,"end":76},{"id":"IPR063304","name":"Cancer/testis antigen 55, N-terminal","type":"domain","start":89,"end":172}],"reasoning":"I begin with the InterPro architecture. The N-terminus carries IPR063973 (RNA helicase Mov10l1-like, N-terminal OB domain, residues 18–76), immediately followed and reinforced by IPR012340 (Nucleic acid-binding, OB-fold homologous superfamily, residues 36–99). OB-folds create a curved β-barrel that binds single-stranded nucleic acids and frequently nucleate higher-order assemblies; in Mov10l1-like systems they act as RNA-recognition and scaffolding modules that position RNA and partner proteins. Downstream, IPR063304 (Cancer/testis antigen 55, N-terminal, residues 89–172) extends this N-terminal platform with a CT antigen-like module known to mediate protein–protein interactions and to target the complex to cytoplasmic RNA granules. The ordered layout—an OB-fold core that transitions into a CT antigen-like interaction hub—causes a composite behavior: high-affinity nucleic-acid engagement coupled to multivalent protein binding.\n\nThis architecture dictates molecular function. The OB-fold pair (IPR063973 and IPR012340) confers nucleic-acid recognition and assembly of ribonucleoprotein particles, while the CT antigen-like region (IPR063304) supplies docking surfaces for accessory factors. Together they produce a scaffold that primarily operates through multivalent contacts, supporting GO:0005515 protein binding as the operative molecular function. The absence of canonical helicase catalytic motifs and the presence of interaction-rich modules argue that RNA remodeling is achieved indirectly—by recruiting or stabilizing other RNA helicases and decay factors rather than by intrinsic unwinding.\n\nFrom function to process, OB-fold-driven RNP assembly is a hallmark of germ cell RNA regulation. By concentrating and handing off target transcripts to decay or storage pathways, this scaffold modulates the transcriptome during late germ cell differentiation. Such control aligns with GO:0007286 spermatid development, where precise RNA utilization is essential for acrosome biogenesis and cytoplasmic remodeling.\n\nCellular location follows from the same logic. OB-fold RNP scaffolds typically reside in the cytoplasm, consistent with the experimentally observed cytoplasmic localization. The CT antigen-like region often targets RNA granules and trafficking hubs; transient association with membrane-proximal RNP assemblies explains detection at the GO:0005794 Golgi apparatus, where RNA–protein complexes interface with vesicle biogenesis during spermiogenesis. Thus, the dominant residence is cytoplasmic, with Golgi-proximal assemblies arising from functional coupling.\n\nMechanistically, I hypothesize that the OB-fold core captures specific RNA substrates and presents them to decay or storage machineries, while the CT antigen-like domain recruits effector complexes. In germ cells, this would tune mRNA stability and translation during spermatid maturation. Likely partners include RNA decay and surveillance modules (e.g., RNA exosome adaptors and MOV10-family assemblies), cytoplasmic granule organizers, and Golgi-associated trafficking factors that coordinate vesicle-mediated remodeling. Through these assemblies, the protein acts as a cytoplasmic RNP scaffold that channels transcripts toward pathways critical for spermatid development.","category":"dark","control_evaluation":null,"validation_plan":null,"structure":{"source":"AlphaFold DB","pdb":"/structures/AF-Q8WUE5.pdb","alphafold":"https://alphafold.ebi.ac.uk/entry/Q8WUE5"},"links":{"uniprot":"https://www.uniprot.org/uniprotkb/Q8WUE5/entry","atlas":"/p/Q8WUE5"},"provenance":{"model":"BioReason-Pro (ESM3 esm3-sm-open-v1)","source_list":"Pharos Tdark","note":"AI prediction, not experimentally verified"}}